KEGG   Bacteroides thetaiotaomicron: BT_0551Help
Entry
BT_0551           CDS       T00122                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bth00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(676966..678645)
Genome map
AA seq 559 aa AA seqDB search
MCGIAGILNIKTQTKELRDKALKMAQKIRHRGPDWSGIYVGGSAILAHERLSIVDPQSGG
QPLYSPDRKQALAVNGEIYNHRDIRARYAGQYDFQTGSDCEVILALYKDKGIHFLEEISG
IFAFVLYDEEKDEFLIARDPIGVIPLYIGKDKDGKIYFGSELKALEGFCNEYEPFLPGHY
FYSKEGKMKRWYTREWTDYESVKDNDAKVSDVKEALEDAVHRQLMSDVPYGVLLSGGLDS
SVISAIAKKYAAKRIETDGASDAWWPQLHSFAIGLKGAPDLIKAREVAEYIGTVHHEINY
TVQEGLDAIRDVIYFIETYDVTTVRASTPMYLLARVIKSMGIKMVLSGEGADEVFGGYLY
FHKAPTPKDFHEETVRKLSKLHMYDCLRANKSLSAWGVEGRVPFLDKEFLDVAMALNPKA
KMCPGKEIEKRIVREAFADMLPESVAWRQKEQFSDGVGYSWIDTLREITAAAVSDEQMEH
AAERFPINTPLNKEEYYYRSIFEEHFPSESAARSVPSVPSVACSTAEALAWDVAFRNLNE
PSGRAVRGVHEEAYAEEVK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagcaggtatactcaacataaaaactcaaaccaaagagctaagagacaaa
gcactgaaaatggcacagaaaatccgtcatcgcggaccggactggagcggtatctacgta
ggtggaagcgccattctggcacacgaacgcctctcgatagttgacccgcaaagcggagga
cagcccttatactcccccgaccggaaacaagcgctcgccgtgaacggtgaaatctacaac
catcgggatatccgcgcccgctatgccggacaatatgattttcagaccggaagcgactgt
gaagtgattcttgccctttataaagataaaggcatccactttctggaagagatcagcgga
attttcgcctttgtactttatgatgaagaaaaagacgagttcctcattgcacgtgatcct
atcggagtcatacctttatatataggaaaagacaaggatggcaaaatctacttcggcagt
gaactgaaagcactcgaaggattctgtaatgagtacgaaccatttcttccgggacattac
ttttacagtaaagaaggcaaaatgaagcgttggtatacacgcgaatggacagactatgag
tctgtaaaagacaatgatgccaaagtcagtgatgtaaaagaagcattggaagatgccgtt
catcgccagctgatgagtgacgttccctatggagtacttctttcaggtggtctggacagt
tctgtgatttcagctatcgccaaaaaatatgcagcaaaacgtattgaaacagacggagca
agtgacgcctggtggcctcaactacattcttttgccatcggtctgaagggggcgcccgat
ttgataaaggcacgtgaagtggcagaatatatcggtacggttcatcatgaaatcaattat
acggttcaggaagggctggatgctattcgggatgttatctattttatcgagacgtatgat
gtgactacggtacgtgcctccactcccatgtatttactggcacgtgtgatcaaatcgatg
gggatcaaaatggtattgagtggtgaaggtgccgatgaagttttcggcggttatctttac
tttcacaaagctcccactccgaaagatttccatgaggaaacggtacgtaagttatcaaaa
ctgcatatgtatgattgccttcgtgccaataagagtttatcagcctggggtgtagaggga
cgtgtcccatttctggacaaggaatttctggatgtagcgatggcgttgaatccaaaagct
aaaatgtgccccggaaaggagattgagaaacgaattgtacgtgaagcttttgccgatatg
ctaccggaaagcgtagcatggagacaaaaagagcagttcagtgatggtgtgggatattcg
tggattgataccttaagagagattacagcggctgccgtcagtgatgaacagatggaacac
gctgccgaacgtttcccgattaacactccgctcaacaaggaagaatattactaccggagt
atctttgaagagcattttccgagtgaaagcgcagcccgcagcgtaccaagcgtaccaagt
gtggcctgctctacagcagaagcgctggcatgggatgtagctttccgtaacctgaatgaa
ccaagcggcagagcagtgagaggagtgcatgaagaagcctatgccgaagaggtaaaataa

DBGET integrated database retrieval system