KEGG   Bacteroides thetaiotaomicron: BT_0554Help
Entry
BT_0554           CDS       T00122                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bth00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bth00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
685280..687124
Genome map
AA seq 614 aa AA seqDB search
MCGIVGYIGKRKAYPILIKGLKRLEYRGYDSAGVALISDNQQLNVYKTKGKVSELENFVT
QKDISGTVGIAHTRWATHGEPCSVNAHPHYSSSEKLALIHNGIIENYAVLKEKLQAKGYV
FKSSTDTEVLVQLIEYMKVTNRVDLLTAVQLALNEVIGAYAIAILDKEHPEEIIAARKSS
PLVVGIGEDEFFLASDATPIVEYTDKVVYLEDGEIAVINRGKELKVVDLSNVEMTPEVKK
VELKLGQLEKGGYPHFMLKEIFEQPDCIHDCMRGRINVEANNVVLSAVIDYKEKLLNAKR
FIIVACGTSWHAGLIGKHLIESFCRIPVEVEYASEFRYRDPVIDEHDVVIAISQSGETAD
TLAAVELAKSRGAFIYGICNAIGSSIPRATHTGSYIHVGPEIGVASTKAFTGQVTVLTML
ALTLAREKGTIDETQYLNIVRELNSIPGKMKEVLKLNDKLAELSKTFTYAHNFIYLGRGY
SYPVALEGALKLKEISYIHAEGYPAAEMKHGPIALIDAEMPVVVIATQNGLYEKVLSNIQ
EIKARKGKVIAFVTKGDTVISKIADCSIELPETIECLDPLITTVPLQLLAYHIAVCKGMD
VDQPRNLAKSVTVE
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagtaggctatattggtaaaagaaaagcctaccccatccttattaaaggg
ctgaagcgactggagtatcgtggatatgacagtgcaggggtagcattgatcagtgataac
caacagttaaatgtgtacaagacgaaagggaaagtctccgaacttgaaaatttcgtcaca
caaaaagatatttccggtacagtcggaattgcccatacccgttgggctactcacggggaa
ccttgttccgttaatgctcatcctcattactcttcttccgaaaaactcgctctcattcat
aacggtatcattgaaaattacgccgttctcaaagaaaaactccaagccaaaggctacgtc
tttaaaagtagtaccgataccgaggtgctcgttcaattaatcgaatatatgaaagttacc
aatcgggtcgatctgcttactgccgttcagttggctttgaatgaagtgattggtgcttat
gcgattgcgattcttgataaagagcatccggaagaaatcattgcggcccgcaaaagcagt
ccgctggtggtaggtattggtgaagatgagtttttccttgcttcggatgccacaccgatt
gtagaatatacagataaggtggtatacctcgaagatggtgagatagcggtgatcaatcgg
ggaaaagagctgaaggtagtcgaccttagtaatgtggaaatgactcccgaagtgaaaaaa
gtagaattgaagcttggccagctggaaaaaggaggttatccgcatttcatgttgaaggag
atttttgagcagccggactgtattcacgattgtatgcgtggacgtatcaatgtggaagcc
aataacgtggtgctttcggcagtaatagactataaagaaaagttgctgaacgccaaacgc
tttattattgtggcttgcggtacttcgtggcatgcgggattgatcgggaagcatctgatt
gaaagtttttgccgtattccggtagaagtggagtatgcctccgaatttcgttaccgtgat
ccggtgatcgatgagcacgatgtggtgattgccatttctcaaagtggagaaacggcggat
acgctggcggcagtggaactggcaaaaagtcggggtgcatttatatatggtatctgtaat
gcgattggttcctccatcccccgcgctacgcatacggggtcgtacatccacgtcggaccg
gaaatcggagtggcatcgaccaaagcatttaccggacaggtgactgtgctgaccatgctg
gcattgactctcgcccgggagaaaggtacgatagacgagacacaatacctgaacattgta
cgggaattgaatagcattcccggcaaaatgaaggaagtattgaaactgaatgataagctg
gcggaactgtcgaaaactttcacctatgcgcataactttatttacctcggacgcggatat
agttatccggttgctttggaaggtgcattgaaattgaaagaaatatcgtatattcacgcc
gaaggttatccggctgccgaaatgaagcacggaccgatagccctgattgatgccgaaatg
ccggtagtagtcattgctacccaaaacgggttgtatgagaaagtacttagcaatattcag
gaaatcaaggcacgaaaaggaaaggtgattgcatttgtaaccaagggcgatacggtgatc
agtaaaatagccgattgcagtatcgaacttccggaaacaatcgagtgccttgatccgtta
attactacggtacctctccagttgcttgcttatcatattgcggtatgtaaggggatggat
gtagaccaacctagaaatttggctaagtcggtaacagtcgagtag

DBGET integrated database retrieval system