KEGG   Bacteroides thetaiotaomicron: BT_0554Help
Entry
BT_0554           CDS       T00122                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BT_0554
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BT_0554
Enzymes [BR:bth01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     BT_0554
Peptidases [BR:bth01002]
 Cysteine Peptidases
  Family C44
   BT_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
685280..687124
Genome map
AA seq 614 aa AA seqDB search
MCGIVGYIGKRKAYPILIKGLKRLEYRGYDSAGVALISDNQQLNVYKTKGKVSELENFVT
QKDISGTVGIAHTRWATHGEPCSVNAHPHYSSSEKLALIHNGIIENYAVLKEKLQAKGYV
FKSSTDTEVLVQLIEYMKVTNRVDLLTAVQLALNEVIGAYAIAILDKEHPEEIIAARKSS
PLVVGIGEDEFFLASDATPIVEYTDKVVYLEDGEIAVINRGKELKVVDLSNVEMTPEVKK
VELKLGQLEKGGYPHFMLKEIFEQPDCIHDCMRGRINVEANNVVLSAVIDYKEKLLNAKR
FIIVACGTSWHAGLIGKHLIESFCRIPVEVEYASEFRYRDPVIDEHDVVIAISQSGETAD
TLAAVELAKSRGAFIYGICNAIGSSIPRATHTGSYIHVGPEIGVASTKAFTGQVTVLTML
ALTLAREKGTIDETQYLNIVRELNSIPGKMKEVLKLNDKLAELSKTFTYAHNFIYLGRGY
SYPVALEGALKLKEISYIHAEGYPAAEMKHGPIALIDAEMPVVVIATQNGLYEKVLSNIQ
EIKARKGKVIAFVTKGDTVISKIADCSIELPETIECLDPLITTVPLQLLAYHIAVCKGMD
VDQPRNLAKSVTVE
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagtaggctatattggtaaaagaaaagcctaccccatccttattaaaggg
ctgaagcgactggagtatcgtggatatgacagtgcaggggtagcattgatcagtgataac
caacagttaaatgtgtacaagacgaaagggaaagtctccgaacttgaaaatttcgtcaca
caaaaagatatttccggtacagtcggaattgcccatacccgttgggctactcacggggaa
ccttgttccgttaatgctcatcctcattactcttcttccgaaaaactcgctctcattcat
aacggtatcattgaaaattacgccgttctcaaagaaaaactccaagccaaaggctacgtc
tttaaaagtagtaccgataccgaggtgctcgttcaattaatcgaatatatgaaagttacc
aatcgggtcgatctgcttactgccgttcagttggctttgaatgaagtgattggtgcttat
gcgattgcgattcttgataaagagcatccggaagaaatcattgcggcccgcaaaagcagt
ccgctggtggtaggtattggtgaagatgagtttttccttgcttcggatgccacaccgatt
gtagaatatacagataaggtggtatacctcgaagatggtgagatagcggtgatcaatcgg
ggaaaagagctgaaggtagtcgaccttagtaatgtggaaatgactcccgaagtgaaaaaa
gtagaattgaagcttggccagctggaaaaaggaggttatccgcatttcatgttgaaggag
atttttgagcagccggactgtattcacgattgtatgcgtggacgtatcaatgtggaagcc
aataacgtggtgctttcggcagtaatagactataaagaaaagttgctgaacgccaaacgc
tttattattgtggcttgcggtacttcgtggcatgcgggattgatcgggaagcatctgatt
gaaagtttttgccgtattccggtagaagtggagtatgcctccgaatttcgttaccgtgat
ccggtgatcgatgagcacgatgtggtgattgccatttctcaaagtggagaaacggcggat
acgctggcggcagtggaactggcaaaaagtcggggtgcatttatatatggtatctgtaat
gcgattggttcctccatcccccgcgctacgcatacggggtcgtacatccacgtcggaccg
gaaatcggagtggcatcgaccaaagcatttaccggacaggtgactgtgctgaccatgctg
gcattgactctcgcccgggagaaaggtacgatagacgagacacaatacctgaacattgta
cgggaattgaatagcattcccggcaaaatgaaggaagtattgaaactgaatgataagctg
gcggaactgtcgaaaactttcacctatgcgcataactttatttacctcggacgcggatat
agttatccggttgctttggaaggtgcattgaaattgaaagaaatatcgtatattcacgcc
gaaggttatccggctgccgaaatgaagcacggaccgatagccctgattgatgccgaaatg
ccggtagtagtcattgctacccaaaacgggttgtatgagaaagtacttagcaatattcag
gaaatcaaggcacgaaaaggaaaggtgattgcatttgtaaccaagggcgatacggtgatc
agtaaaatagccgattgcagtatcgaacttccggaaacaatcgagtgccttgatccgtta
attactacggtacctctccagttgcttgcttatcatattgcggtatgtaaggggatggat
gtagaccaacctagaaatttggctaagtcggtaacagtcgagtag

DBGET integrated database retrieval system