KEGG   Bacteroides thetaiotaomicron: BT_0771Help
Entry
BT_0771           CDS       T00122                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bth00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960466..962478
Genome map
AA seq 670 aa AA seqDB search
MKETLNIIKNDPWLEPFADAITGRHQYALNKEAELTNKGKQTLSDFASGYLYFGLHRTPK
GWTFREWAPNATHIYMVGTFNNWEEKAAYKLKKLKNGNWEINLPADAIHHGDLYKLNVYW
DGGQGERIPAWATRVVQDEQTKIFSAQVWAPEKPYKFKKKTFKPTTNPLLIYECHIGMAQ
QEEKVGTYNEFREKTLPRIAQEGYNCIQIMAIQEHPYYGSFGYHVSSFFAASSRFGTPDE
LKALIDAAHEMGIAVIMDIVHSHAVKNEVEGLGNFAGDPNQYFYPAPRREHPAWDSLCFD
YGKNEVIHFLLSNCKYWLEEYKFDGFRFDGVTSMLYYSHGLGEAFCNYGDYFNGHQDGNA
ICYLTLANELIHQVNPKAISIAEEVSGMPGLAAKVEDGGYGFDYRMAMNIPDYWIKTIKE
KIDEDWKPSSMFWEVTNRRQDEKTISYAESHDQALVGDKTIIFRLIDADMYWHMQKGDEN
YVVNRGIALHKMIRLLTSSTINGGYLNFMGNEFGHPEWIDFPREGNGWSCKYARRQWDLV
DNKNLAYHYMGDFDAEMLKVIKSVKDFQATPVQEIWHNDGDQVLAYGRKDLIFVFNFNPK
QSFVDYGFLVSPGAYEVILNTDNVAFGGNGLADDSVVHFTIADPLYKKEKKEWLKLYIPA
RTAVVLRKKK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagacactcaacattatcaaaaacgatccctggctggaacctttcgcagatgcc
attaccggtcgtcaccagtatgcactgaacaaggaagccgagttgaccaataaaggaaaa
caaactctttcggactttgcatcaggctatctttattttggtctgcaccgtactcccaaa
ggatggacgttccgcgaatgggcaccgaatgctactcatatttatatggtaggtacattc
aacaactgggaagagaaagctgcttataagctgaaaaaactgaaaaacggtaattgggaa
atcaatcttccggcagatgccattcatcacggagacttatataagttgaatgtgtattgg
gatggcggacaaggtgaacgcattcctgcatgggctacacgtgtggtgcaggacgagcag
accaagatattcagcgcacaagtctgggcaccggaaaagccatataaattcaagaaaaag
acatttaagcctactacgaatcctttgttgatctatgaatgtcatattggaatggcacaa
caggaggaaaaagtaggcacatacaatgaattccgcgaaaaaacacttccacgcatagca
caggaaggctataactgtattcagattatggccattcaggagcatccttattatggtagt
tttggctatcatgtatccagtttctttgctgcttcctcccgctttggtacgcctgacgaa
ctgaaagcgctgattgatgctgctcatgagatggggattgccgttattatggatattgtc
cattctcatgcggtgaaaaacgaagtggaaggtttgggcaactttgccggtgatccgaac
cagtatttctatccggctcctcgtcgtgagcatccggcatgggattcactatgctttgat
tatggtaaaaatgaagtgatccatttcttattgtccaactgtaaatactggctggaagaa
tataagtttgacggattccgttttgacggtgtgacgtctatgttgtattatagccacggg
ttgggagaagcattctgtaattatggagattacttcaatggtcatcaggacggcaatgcc
atttgctacctgacattggcgaatgagttgattcatcaggtcaatccgaaggctatctct
attgctgaagaagtttccggtatgccgggacttgccgccaaagtagaagatggcggttac
ggatttgattaccgtatggctatgaacatccctgattactggatcaagactatcaaggaa
aagattgatgaggactggaaaccttccagtatgttctgggaagtaaccaaccgtcgtcag
gatgaaaagacgatctcttatgcggaaagtcatgatcaggcattggtaggagacaagact
attattttccgtctgattgatgccgatatgtattggcatatgcagaaaggcgatgagaat
tatgtagtcaatcgcggaatcgctttacataagatgatccgcttgctgacatcttcgacg
atcaatggcggttatctgaactttatgggtaatgagttcgggcatcccgaatggatcgat
tttccgcgtgaaggtaatggatggtcttgtaagtatgcccgtcgtcagtgggatctggta
gataacaagaatctggcttatcactacatgggggactttgatgctgagatgctgaaagtg
atcaagagtgtgaaagatttccaggcgactccggtccaggagatctggcataatgatggt
gatcaggtattggcttatggacgtaaggatctgatatttgtatttaacttcaatccgaaa
cagtcttttgtagattatggtttcctcgttagtccgggagcttatgaagtaatcttgaat
acggataatgttgcatttggcggaaatggtcttgcagatgattcagtagttcatttcacg
attgccgatccgttgtataagaaggaaaagaaagagtggctgaaactctatattcctgca
cgtacagctgttgttttgagaaagaagaaataa

DBGET integrated database retrieval system