KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_0771Help
Entry
BT_0771           CDS       T00122                                 

Definition
(RefSeq) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00500  Starch and sucrose metabolism
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BT_0771
Enzymes [BR:bth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BT_0771
Exosome [BR:bth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BT_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase CBM_48 AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 1073748
NCBI-ProteinID: NP_809684
UniProt: Q8A9P4
Position
960466..962478
Genome map
AA seq 670 aa AA seqDB search
MKETLNIIKNDPWLEPFADAITGRHQYALNKEAELTNKGKQTLSDFASGYLYFGLHRTPK
GWTFREWAPNATHIYMVGTFNNWEEKAAYKLKKLKNGNWEINLPADAIHHGDLYKLNVYW
DGGQGERIPAWATRVVQDEQTKIFSAQVWAPEKPYKFKKKTFKPTTNPLLIYECHIGMAQ
QEEKVGTYNEFREKTLPRIAQEGYNCIQIMAIQEHPYYGSFGYHVSSFFAASSRFGTPDE
LKALIDAAHEMGIAVIMDIVHSHAVKNEVEGLGNFAGDPNQYFYPAPRREHPAWDSLCFD
YGKNEVIHFLLSNCKYWLEEYKFDGFRFDGVTSMLYYSHGLGEAFCNYGDYFNGHQDGNA
ICYLTLANELIHQVNPKAISIAEEVSGMPGLAAKVEDGGYGFDYRMAMNIPDYWIKTIKE
KIDEDWKPSSMFWEVTNRRQDEKTISYAESHDQALVGDKTIIFRLIDADMYWHMQKGDEN
YVVNRGIALHKMIRLLTSSTINGGYLNFMGNEFGHPEWIDFPREGNGWSCKYARRQWDLV
DNKNLAYHYMGDFDAEMLKVIKSVKDFQATPVQEIWHNDGDQVLAYGRKDLIFVFNFNPK
QSFVDYGFLVSPGAYEVILNTDNVAFGGNGLADDSVVHFTIADPLYKKEKKEWLKLYIPA
RTAVVLRKKK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagacactcaacattatcaaaaacgatccctggctggaacctttcgcagatgcc
attaccggtcgtcaccagtatgcactgaacaaggaagccgagttgaccaataaaggaaaa
caaactctttcggactttgcatcaggctatctttattttggtctgcaccgtactcccaaa
ggatggacgttccgcgaatgggcaccgaatgctactcatatttatatggtaggtacattc
aacaactgggaagagaaagctgcttataagctgaaaaaactgaaaaacggtaattgggaa
atcaatcttccggcagatgccattcatcacggagacttatataagttgaatgtgtattgg
gatggcggacaaggtgaacgcattcctgcatgggctacacgtgtggtgcaggacgagcag
accaagatattcagcgcacaagtctgggcaccggaaaagccatataaattcaagaaaaag
acatttaagcctactacgaatcctttgttgatctatgaatgtcatattggaatggcacaa
caggaggaaaaagtaggcacatacaatgaattccgcgaaaaaacacttccacgcatagca
caggaaggctataactgtattcagattatggccattcaggagcatccttattatggtagt
tttggctatcatgtatccagtttctttgctgcttcctcccgctttggtacgcctgacgaa
ctgaaagcgctgattgatgctgctcatgagatggggattgccgttattatggatattgtc
cattctcatgcggtgaaaaacgaagtggaaggtttgggcaactttgccggtgatccgaac
cagtatttctatccggctcctcgtcgtgagcatccggcatgggattcactatgctttgat
tatggtaaaaatgaagtgatccatttcttattgtccaactgtaaatactggctggaagaa
tataagtttgacggattccgttttgacggtgtgacgtctatgttgtattatagccacggg
ttgggagaagcattctgtaattatggagattacttcaatggtcatcaggacggcaatgcc
atttgctacctgacattggcgaatgagttgattcatcaggtcaatccgaaggctatctct
attgctgaagaagtttccggtatgccgggacttgccgccaaagtagaagatggcggttac
ggatttgattaccgtatggctatgaacatccctgattactggatcaagactatcaaggaa
aagattgatgaggactggaaaccttccagtatgttctgggaagtaaccaaccgtcgtcag
gatgaaaagacgatctcttatgcggaaagtcatgatcaggcattggtaggagacaagact
attattttccgtctgattgatgccgatatgtattggcatatgcagaaaggcgatgagaat
tatgtagtcaatcgcggaatcgctttacataagatgatccgcttgctgacatcttcgacg
atcaatggcggttatctgaactttatgggtaatgagttcgggcatcccgaatggatcgat
tttccgcgtgaaggtaatggatggtcttgtaagtatgcccgtcgtcagtgggatctggta
gataacaagaatctggcttatcactacatgggggactttgatgctgagatgctgaaagtg
atcaagagtgtgaaagatttccaggcgactccggtccaggagatctggcataatgatggt
gatcaggtattggcttatggacgtaaggatctgatatttgtatttaacttcaatccgaaa
cagtcttttgtagattatggtttcctcgttagtccgggagcttatgaagtaatcttgaat
acggataatgttgcatttggcggaaatggtcttgcagatgattcagtagttcatttcacg
attgccgatccgttgtataagaaggaaaagaaagagtggctgaaactctatattcctgca
cgtacagctgttgttttgagaaagaagaaataa

DBGET integrated database retrieval system