KEGG   Bacteroides thetaiotaomicron: BT_0788Help
Entry
BT_0788           CDS       T00122                                 

Definition
succinyl-CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bth01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bth00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bth00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:bth00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(977227..978357)
Genome map
AA seq 376 aa AA seqDB search
MKIHEYQAKEIFSKYGIPVERHTLCRTAAGAVAAYKRMGSDRVVIKAQVLTGGRGKAGGV
KLVDNTEDTYQEAKNILGMSIKGLPVNQILVSEAVDIAAEYYVSFTIDRNTRSVILMMSA
SGGMDIEEVARQSPEKIIRYAIDPFIGLPDYLARRFAFSLFPHIEQAGRMAAILQALYKI
FMENDASLVEVNPLALTAKGILMAIDAKIVFDDNALYRHPDVLSLFDPTEEEKVEADAKN
KGFSYVHMDGNIGCMVNGAGLAMATMDMIKLHGGNPANFLDIGGSSNPVKVVEAMKLLLQ
DEKVKVVLINIFGGITRCDDVAIGLIQAFDQIKSDIPVIVRLTGTNEHLGRDLLRNHSRF
QIATTMQEAALMAIKS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacatgaatatcaagcaaaagaaattttctccaagtatgggatccctgttgaa
aggcataccctatgtcgaacggctgccggcgcagttgccgcatacaagagaatgggctcg
gacagagtggttattaaagcacaagtgctgaccggcggacggggaaaagccggaggtgtt
aaactggtagataatacagaagatacctatcaggaagctaaaaacattctgggtatgagt
attaaagggcttcctgtcaatcagatactggtcagcgaggcggttgatattgccgcagaa
tactatgtcagcttcaccattgacagaaacacacgctcggtcatccttatgatgagtgcg
tccggtggtatggatatcgaagaagtagcccggcaatcaccggaaaaaatcattcgctat
gctattgacccattcatcggtctgcctgattatctggcacgccgtttcgcattctcgctc
ttccctcacatagaacaagccggcagaatggccgctattctgcaagcactctacaaaatt
ttcatggagaatgacgcatcgctggttgaagtaaatccattggctcttaccgccaaaggc
atattgatggctattgacgccaaaattgtttttgacgataatgctctttaccgccatccg
gatgtactgagtttgtttgatcctacagaagaagaaaaagtagaagcggatgctaaaaac
aaaggattcagctacgttcacatggatggaaatataggctgtatggtaaatggcgccgga
cttgctatggcaacaatggatatgataaaacttcatgggggaaatcctgccaacttcctt
gatattggcggtagttcgaaccctgtcaaggtggttgaagctatgaaacttctcttacag
gacgagaaagtaaaggtcgtcctgataaacattttcggaggaatcacccgttgtgacgat
gtagccatcggtcttattcaggcattcgatcagattaagagtgatatacctgtcattgtc
cggctcacaggaaccaatgagcatctcggacgtgatcttttacgcaaccatagccgtttt
cagatagctacaactatgcaggaagccgctttaatggctatcaaatcttaa

DBGET integrated database retrieval system