KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_1102Help
Entry
BT_1102           CDS       T00122                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00010  Glycolysis / Gluconeogenesis
bth00030  Pentose phosphate pathway
bth00051  Fructose and mannose metabolism
bth00052  Galactose metabolism
bth00680  Methane metabolism
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01130  Biosynthesis of antibiotics
bth01200  Carbon metabolism
bth01230  Biosynthesis of amino acids
bth03018  RNA degradation
Module
bth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT_1102 (pfkA)
   00030 Pentose phosphate pathway
    BT_1102 (pfkA)
   00051 Fructose and mannose metabolism
    BT_1102 (pfkA)
   00052 Galactose metabolism
    BT_1102 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BT_1102 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BT_1102 (pfkA)
Enzymes [BR:bth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BT_1102 (pfkA)
Protein phosphatases and associated proteins [BR:bth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BT_1102 (pfkA)
Messenger RNA biogenesis [BR:bth03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BT_1102 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Chlam_PMP
Motif
Other DBs
NCBI-GeneID: 1073299
NCBI-ProteinID: NP_810015
UniProt: Q8A8R5
Position
complement(1391513..1392496)
Genome map
AA seq 327 aa AA seqDB search
MDNKYIGILTSGGDASGMNAAIRAVTRAAIFNGFKVKGIYRGYEGLIAGEVKELTTEDVS
SIIQRGGTILKTARSETFTTPEGRKKAYKVIQKENINALIIIGGDGSLTGARIFAEEYDV
TCIGLPGTIDNDLYGTDFTIGYDTALNTIVECVDKIRDTATSHDRIFFVEVMGRDAGFLA
QNSAIASGAEAAIIPEDRTDVDQLETFIGRGFRKTKNSSIVIVTESPENKNGGAIYYADR
VKKEYPGYDVRVSILGHLQRGGAPSANDRILASRLGEAAIQALMEGQRNVMIGIRNNEIV
YVPFVQAIKKDKPIDKSLIRVLNELSI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggataacaagtatattggaattctgacttccggaggggatgcttcaggaatgaacgcg
gctatccgtgccgtgacccgcgccgccatttttaacggatttaaagtgaaaggaatttat
agaggttacgaggggctgattgccggtgaagtgaaagaactcacgacggaagatgtaagt
agcattatccagaggggaggcaccatactgaaaacagctcgctccgagactttcaccact
cccgaaggacgcaagaaagcttataaggtcatacagaaagagaacatcaatgctttgata
attatcggtggagacggttccctgacgggagcccgtatctttgcggaggagtatgatgtg
acgtgcataggattgcccggcaccattgacaatgacctatatggtaccgattttaccata
ggatatgatacggcattgaacaccattgtggaatgcgtggataaaatcagggacacggca
acctcccatgaccgtatcttctttgtcgaagtgatggggcgtgatgcgggcttcctggca
caaaacagcgcaatagcttccggtgctgaagcggccatcatcccggaggacaggacggac
gtggaccagttggaaacattcatcgggcgcggattcagaaagacgaaaaacagcagcatc
gtaattgtgaccgaaagtcctgaaaacaagaatggaggtgccatatattacgccgaccgg
gtaaagaaggaatatcccgggtatgatgtcagggtttctatcctgggccatctgcaacgg
ggtggtgctccgagtgccaatgaccgtatactggcaagccggctgggtgaagccgcaatc
caggccttaatggaaggccagcgaaatgttatgataggcatacggaacaacgagattgtt
tatgttccttttgtccaggcaatcaaaaaggacaagcctattgacaaaagcctgatccgg
gtccttaacgaattatcgatctaa

DBGET integrated database retrieval system