KEGG   Bacteroides thetaiotaomicron: BT_1220Help
Entry
BT_1220           CDS       T00122                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:bth01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bth00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1517499..1518188)
Genome map
AA seq 229 aa AA seqDB search
METARSLIFHLVDIMNAEPDKTFNIAVSGGSTPALMFDLWANEYADITPWKRMKLYWVDE
RCVPPEDSDSNYGMMRSLLLGIVPIPYENVFRIRGEVKPAKEAVRYSELVSQQVPKKNGW
PEFDIVLLGAGDDGHTSSIFPGQEALLSSDQIYVTSTHPRNGQKRIAMTGFPILTARLVI
FLITGKAKAEVVEEICHSGDTGPAAYIAHHAENVELFMDAGAAMYVRND
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggagacagcccgttcgttgatattccacctggtggatatcatgaatgctgaaccggac
aaaacgttcaacatagcagtgagtggtggcagcactcccgccttgatgtttgatttatgg
gcaaatgaatacgctgatattactccttggaagcgtatgaaactttattgggtagacgaa
cgttgcgttcctcccgaagattctgatagtaattatggaatgatgcgttccctgcttttg
gggatagtgcccattccttacgaaaatgtattccgcatccgcggagaagtgaaaccggca
aaagaagcggtccgctattccgaacttgtcagccagcaggtacccaagaaaaatggctgg
cccgaatttgacattgtgctgttgggagcgggagatgacggacatacttcctctatcttc
cccggacaggaggctttgctctcttccgaccagatttatgtgaccagcactcatccccgc
aacggacagaaacgtattgcaatgaccggatttccgatcttgaccgctcgccttgttatt
tttctgattaccggaaaggcgaaggcggaagtggtggaagaaatttgccactcgggagat
acggggccggcggcttatatagcgcatcatgcggagaatgtcgaactctttatggatgcc
ggagccgcgatgtatgtgcggaatgactga

DBGET integrated database retrieval system