KEGG   Bacteroides thetaiotaomicron: BT_1228Help
Entry
BT_1228           CDS       T00122                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT_1228
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT_1228
   00030 Pentose phosphate pathway
    BT_1228
   00051 Fructose and mannose metabolism
    BT_1228
  Energy metabolism
   00680 Methane metabolism
    BT_1228
Enzymes [BR:bth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BT_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1528929..1530923)
Genome map
AA seq 664 aa AA seqDB search
MTAQSNITPESIVGDLRYLQLLSRSFPTIADASTEIINLEAILNLPKGTEHFLTDIHGEY
EAFQHVLKNASGAVKRKVNEIFGNTLREAEKKELCTLIYYPEEKIQLVKAREKDLDDWYL
ITLNQLVKVCQNVSSKYTRSKVRKSLPAEFSYIIQELLHETSVEPNKHAYINVIISTIIS
TKRADDFIIAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCNYHNFDIQWGNHDILW
MGAASGNDSCIANVIRMSMRYGNLGTLEDGYGINLLPLATFAMDTYADDPCTIFMPKMNF
ADTNYNEKTLRLITQMHKAITIIQFKLEAEIIDRRPEFGMSNRKLLEKIDFERGVFVYEG
KEYALRDTNFPTVDPADPYRLTDEERELVEKIHYSFMNSEKLKKHMRCLFTYGGMYLVSN
SNLLYHASVPLNEDGSFKHVKIRGKEYWGRKLLDKADQLIRTAYFDEEGEDDKEFAMDYI
WYMWCGPEAPLFDKDKMATFERYFLEDKEIQKEKKGYYYTLRNREDICDQILDEFGALGP
HSHIINGHVPVKTIQGEQPMKANGKLFVIDGGFSKAYQPETGIAGYTLVYHSHGMQLVQH
EPFQSRQKAIEEGLDIKSTNFVLEFNSQRMMVKDTDKGKELVTQIQDLKKLLVAYRIGLI
KEKV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcaaagtaatataactcctgaaagcatagttggcgatctccgctacttgcag
ttgctttcccggagttttcctactattgccgatgcaagtacggaaattattaatctggag
gctatcctgaatctgcctaaaggaacggagcatttcttgacagacatacacggtgaatac
gaagccttccaacatgtgttaaagaatgcttcgggtgcggtaaaacgcaaagtgaacgag
attttcggcaataccctgcgcgaagcggagaagaaagaactctgcacgttgatctattat
ccggaagagaaaattcagctggtaaaagcccgcgagaaggatctggacgactggtatctg
atcactctgaaccagttggtgaaggtttgtcagaatgtatcttccaaatatacccgttcc
aaagttcgaaaatccttgcccgcagagttctcttacatcattcaggaattactgcacgaa
acgtctgtcgagccgaataagcacgcatatatcaatgtcatcatcagcaccataatctct
accaagcgggcggatgactttattatagccatgtgtaatctgattcagcgtctgactatt
gattctcttcatattgtgggtgatatatacgaccgtggtcccggagcgcacatcatcatg
gatactttgtgcaattaccacaacttcgacattcaatggggcaaccacgatatcctgtgg
atgggagccgcttccggcaatgacagttgcatagccaacgtgatccgtatgtccatgcgc
tacggcaatctgggtactcttgaagacggttatggaatcaatctgcttcctctggcaact
tttgccatggatacttatgccgatgatccgtgtaccatctttatgccgaagatgaatttt
gccgacaccaattacaatgagaagactttgcgtctgatcacccagatgcacaaggcgatt
acgatcatccagtttaagctggaagctgaaataatagaccgtcgtccggagttcgggatg
agtaaccggaagctgttggagaagatcgattttgagcgtggagtttttgtgtatgaaggc
aaagaatatgccctgcgtgacacaaactttccgaccgtagaccctgccgatccttatcga
ctgaccgacgaagaacgggaacttgtggaaaagattcactattcgtttatgaatagcgag
aagttgaagaagcacatgcgttgcctgtttacgtatggcggaatgtatctggtttccaat
tccaatcttctttatcatgcttcggtacctttgaatgaggatggcagtttcaagcatgtc
aagatacgtggcaaggagtattggggacgcaagttgctcgataaggccgatcagctgatt
cgtactgcatactttgatgaagaaggagaggatgataaagaatttgcgatggactatatc
tggtatatgtggtgtggtccggaagctcctctgtttgataaggataagatggcgactttc
gaacgctattttctggaagacaaggagatacaaaaggaaaagaagggatattactacacg
cttcgcaatcgtgaagatatctgcgatcagatattagatgagttcggggcattgggacct
cattctcatatcatcaatggtcatgtgcctgtaaagactattcaaggagaacagccgatg
aaggcaaatggcaaattgttcgttattgacggaggattttccaaagcctatcagccggag
acgggaattgcgggctatacgcttgtttaccattctcacgggatgcagttggtgcagcac
gagccgttccagtccaggcagaaagccattgaagaagggttggatatcaagtcaaccaac
tttgtactggagttcaattcgcaacggatgatggtgaaagacaccgataaagggaaggaa
cttgtgacgcagattcaggatttgaagaagttgcttgtggcttatcgcatcgggttgatt
aaagagaaagtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system