KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_1228Help
Entry
BT_1228           CDS       T00122                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00010  Glycolysis / Gluconeogenesis
bth00030  Pentose phosphate pathway
bth00051  Fructose and mannose metabolism
bth00680  Methane metabolism
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01130  Biosynthesis of antibiotics
bth01200  Carbon metabolism
Module
bth_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT_1228
   00030 Pentose phosphate pathway
    BT_1228
   00051 Fructose and mannose metabolism
    BT_1228
  Energy metabolism
   00680 Methane metabolism
    BT_1228
Enzymes [BR:bth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BT_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-GeneID: 1073730
NCBI-ProteinID: NP_810141
UniProt: Q8A8D9
Position
complement(1528929..1530923)
Genome map
AA seq 664 aa AA seqDB search
MTAQSNITPESIVGDLRYLQLLSRSFPTIADASTEIINLEAILNLPKGTEHFLTDIHGEY
EAFQHVLKNASGAVKRKVNEIFGNTLREAEKKELCTLIYYPEEKIQLVKAREKDLDDWYL
ITLNQLVKVCQNVSSKYTRSKVRKSLPAEFSYIIQELLHETSVEPNKHAYINVIISTIIS
TKRADDFIIAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCNYHNFDIQWGNHDILW
MGAASGNDSCIANVIRMSMRYGNLGTLEDGYGINLLPLATFAMDTYADDPCTIFMPKMNF
ADTNYNEKTLRLITQMHKAITIIQFKLEAEIIDRRPEFGMSNRKLLEKIDFERGVFVYEG
KEYALRDTNFPTVDPADPYRLTDEERELVEKIHYSFMNSEKLKKHMRCLFTYGGMYLVSN
SNLLYHASVPLNEDGSFKHVKIRGKEYWGRKLLDKADQLIRTAYFDEEGEDDKEFAMDYI
WYMWCGPEAPLFDKDKMATFERYFLEDKEIQKEKKGYYYTLRNREDICDQILDEFGALGP
HSHIINGHVPVKTIQGEQPMKANGKLFVIDGGFSKAYQPETGIAGYTLVYHSHGMQLVQH
EPFQSRQKAIEEGLDIKSTNFVLEFNSQRMMVKDTDKGKELVTQIQDLKKLLVAYRIGLI
KEKV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcaaagtaatataactcctgaaagcatagttggcgatctccgctacttgcag
ttgctttcccggagttttcctactattgccgatgcaagtacggaaattattaatctggag
gctatcctgaatctgcctaaaggaacggagcatttcttgacagacatacacggtgaatac
gaagccttccaacatgtgttaaagaatgcttcgggtgcggtaaaacgcaaagtgaacgag
attttcggcaataccctgcgcgaagcggagaagaaagaactctgcacgttgatctattat
ccggaagagaaaattcagctggtaaaagcccgcgagaaggatctggacgactggtatctg
atcactctgaaccagttggtgaaggtttgtcagaatgtatcttccaaatatacccgttcc
aaagttcgaaaatccttgcccgcagagttctcttacatcattcaggaattactgcacgaa
acgtctgtcgagccgaataagcacgcatatatcaatgtcatcatcagcaccataatctct
accaagcgggcggatgactttattatagccatgtgtaatctgattcagcgtctgactatt
gattctcttcatattgtgggtgatatatacgaccgtggtcccggagcgcacatcatcatg
gatactttgtgcaattaccacaacttcgacattcaatggggcaaccacgatatcctgtgg
atgggagccgcttccggcaatgacagttgcatagccaacgtgatccgtatgtccatgcgc
tacggcaatctgggtactcttgaagacggttatggaatcaatctgcttcctctggcaact
tttgccatggatacttatgccgatgatccgtgtaccatctttatgccgaagatgaatttt
gccgacaccaattacaatgagaagactttgcgtctgatcacccagatgcacaaggcgatt
acgatcatccagtttaagctggaagctgaaataatagaccgtcgtccggagttcgggatg
agtaaccggaagctgttggagaagatcgattttgagcgtggagtttttgtgtatgaaggc
aaagaatatgccctgcgtgacacaaactttccgaccgtagaccctgccgatccttatcga
ctgaccgacgaagaacgggaacttgtggaaaagattcactattcgtttatgaatagcgag
aagttgaagaagcacatgcgttgcctgtttacgtatggcggaatgtatctggtttccaat
tccaatcttctttatcatgcttcggtacctttgaatgaggatggcagtttcaagcatgtc
aagatacgtggcaaggagtattggggacgcaagttgctcgataaggccgatcagctgatt
cgtactgcatactttgatgaagaaggagaggatgataaagaatttgcgatggactatatc
tggtatatgtggtgtggtccggaagctcctctgtttgataaggataagatggcgactttc
gaacgctattttctggaagacaaggagatacaaaaggaaaagaagggatattactacacg
cttcgcaatcgtgaagatatctgcgatcagatattagatgagttcggggcattgggacct
cattctcatatcatcaatggtcatgtgcctgtaaagactattcaaggagaacagccgatg
aaggcaaatggcaaattgttcgttattgacggaggattttccaaagcctatcagccggag
acgggaattgcgggctatacgcttgtttaccattctcacgggatgcagttggtgcagcac
gagccgttccagtccaggcagaaagccattgaagaagggttggatatcaagtcaaccaac
tttgtactggagttcaattcgcaacggatgatggtgaaagacaccgataaagggaaggaa
cttgtgacgcagattcaggatttgaagaagttgcttgtggcttatcgcatcgggttgatt
aaagagaaagtataa

DBGET integrated database retrieval system