KEGG   Bacteroides thetaiotaomicron: BT_1606Help
Entry
BT_1606           CDS       T00122                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bth  Bacteroides thetaiotaomicron
Brite
Enzymes [BR:bth01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BT_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976791..1978173
Genome map
AA seq 460 aa AA seqDB search
MKRSTKLIVAFLVVVAALAVTYRLMHRVPSADLEANVQMQQIITDAGCLRCHTSTPELPF
YANMPVAGKIVMEDVSKAYRAFDMTQMEKDMKEGRPLNPVDLAKVEKVILDGKMPQAKYY
LVHWGASFNDAKKEVALSWVKNHRMGLYTDVAVAPDFINEPIRPIADSISVDVRKVVLGN
LLYHDTRLSADNTVSCASCHGLDTGGVDNKQYSEGVGGQLGGVNAPTVYNAAYNFVQFWD
GRAGTLAEQAAGPPLNPVEMACESFDQIISKLAEDKNFVVAFNEVYPDGLSEKNITNAIQ
EFEKTLLTPNSRFDRYLKGQKDAITADEIAGYDLFKKYDCATCHVGEILGGQSYELIGVQ
HDYFADRQAEMTEEDNGRFKQTKAERDRHRFKVPGLRNIELTAPYFHDGSMATMDDAVRA
MAKYQLGIDLPQPEVDKIVAFLRTLTGEYKGKLLTNKNMI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaagtacaaaactaatcgtagcatttttggtagtcgtggcggcattggcagtc
acttaccgactgatgcaccgggtgccttctgccgatttggaagcaaacgtacagatgcaa
cagattattacggatgcaggatgcctgagatgccatacctcaacaccggaactaccgttc
tatgcaaatatgcctgtcgccggaaaaattgtaatggaagacgtgagcaaagcctatcgc
gctttcgacatgactcagatggagaaagacatgaaggaagggcgccctctcaatccggtt
gacctggctaaagtagaaaaagtaatcctcgacggaaagatgccgcaggcaaagtattac
cttgtacattggggagcttctttcaacgatgcaaagaaagaggtagcactgagctgggta
aaaaatcaccgcatgggactgtataccgatgtagcggtagcacctgatttcattaacgaa
ccgattcgtcctattgccgactcgatctcagtcgatgtacgcaaagtggtcttaggaaat
ctgttgtatcacgacacccgcttatcggcagacaacaccgtttcatgtgccagctgtcat
ggcctggataccggtggcgttgacaacaagcagtattctgaaggagtaggcggtcagttg
ggcggtgtcaatgccccgaccgtatacaatgctgcctataactttgttcaattctgggac
ggacgtgccggaactctggcagaacaagctgccggccctccattgaatccggtagaaatg
gcttgcgagtcattcgatcagatcatcagcaaactggcagaagacaagaatttcgtagta
gcattcaacgaagtatatcccgacggattgagcgaaaagaatatcacaaatgctattcag
gagttcgaaaagacattgctgactcctaattcacgcttcgaccgttatctgaaaggacag
aaagatgccatcaccgcagatgaaatcgccggatacgaccttttcaagaaatatgattgt
gcgacttgtcatgtgggagaaatcctcggcggacaatcttatgaactgatcggtgtacag
catgattatttcgcagaccgtcaggcagaaatgactgaagaagacaacggacgattcaag
cagacaaaagcagagcgtgaccgccaccgcttcaaagtgccgggattgagaaatatcgaa
ctgaccgctccttatttccacgacggcagcatggctactatggatgatgcggttcgcgcc
atggccaaatatcagttaggcatcgacctgccacaaccggaagtagataagattgtcgcc
ttcctccgtacactgaccggagagtataaaggcaaattactgacgaataagaacatgatc
tga

DBGET integrated database retrieval system