KEGG   Bacteroides thetaiotaomicron: BT_1660Help
Entry
BT_1660           CDS       T00122                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT_1660 (gpmA)
   01230 Biosynthesis of amino acids
    BT_1660 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT_1660 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BT_1660 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT_1660 (gpmA)
Enzymes [BR:bth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BT_1660 (gpmA)
Exosome [BR:bth04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BT_1660 (gpmA)
  Exosomal proteins of melanoma cells
   BT_1660 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2051277..2052023)
Genome map
AA seq 248 aa AA seqDB search
MKKIVLLRHGESAWNKENRFTGWTDVDLTEKGVAEAEKAGVTLREYGFNFDKAYTSYLKR
AVKTLNCVLDKMNLDWIPVEKSWRLNEKHYGDLQGLNKAETAEKYGEEQVLIWRRSYDIA
PNPLSESDLRNPRFDYRYHEVSDAELPRTESLKDTIDRIMPYWESDIFPALKDAHTLLVV
AHGNSLRGIIKHLKHISDEDIIKLNLPTAVPYVFEFDENLNVANDYFLGNPEEIRKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagtattacttcgtcatggagagagtgcttggaacaaagaaaaccgtttc
acaggttggacggatgtagacctgacggaaaagggagttgccgaagcggaaaaggcaggc
gtcacgttgagggaatatggcttcaactttgataaagcctatacttcttatctgaaaagg
gcagtcaaaaccttgaactgcgtgcttgataaaatgaatctggactggattcccgtcgag
aagagctggcgtctgaatgagaagcattacggcgatttgcaaggactcaataaggcggaa
acagccgagaaatacggagaagaacaagtgctgatctggcgtcgcagttatgatatagct
cccaatccgctttccgaaagcgatttgagaaatccgcgtttcgattatcgctatcacgaa
gtatccgatgcggaactgccgcgtaccgaatcattaaaagataccatcgaccgtattatg
ccgtactgggagtcggatatattcccggctttaaaagatgcgcataccttgctggttgtc
gcgcatggcaatagtctgcgaggtatcattaagcatttgaaacatatttctgatgaagat
atcatcaaactgaatcttcctactgccgttccttatgtattcgagttcgacgagaacctg
aatgttgccaatgattacttcctgggcaatccggaagaaattcgtaagctgatggaagcg
gtagccaatcaggggaagaaaaaatag

DBGET integrated database retrieval system