KEGG   Bacteroides thetaiotaomicron: BT_2005Help
Entry
BT_2005           CDS       T00122                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BT_2005
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BT_2005
Enzymes [BR:bth01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BT_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2521264..2522568)
Genome map
AA seq 434 aa AA seqDB search
MASFVIEGGHRLSGEIHPQGAKNEVLQIICATLLTAEEVTVNNIPDILDVNNLIQLMREM
GVTVAKEGIDTYSFKAENVDLAYLESDKFLKKCSSLRGSVMLIGPMVARFGKALISKPGG
DKIGRRRLDTHFVGIQNLGADFRYDESRGIYEITADRLQGSYMLLDEASVTGTANILMAA
VLAKGTTTIYNAACEPYLQQLCRMLNRMGAKISGIASNLLTIEGVEELHGTQHTVLPDMI
EVGSFIGMAAMTKSEITIKNVSYENLGIIPESFRRLGIKLEQRGDDIYVPAQETYEIESF
IDGSIMTIADAPWPGLTPDLLSVMLVVATQAKGSVLIHQKMFESRLFFVDKLIDMGAQII
LCDPHRAVVIGHNHGFKLRGARLTSPDIRAGIALLIAAMSAEGTSTISNIEQIDRGYQNI
EGRLNAIGARITRI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatttgtaattgaaggaggacatcggcttagcggggagattcatccgcaaggg
gccaaaaacgaagttttgcagattatctgtgccacgttgctgactgctgaggaagtgacg
gtgaacaatatacctgacattctggatgtcaacaatctgattcagcttatgcgggagatg
ggagtgacggttgcaaaggaaggcattgatacttacagttttaaggcggagaacgtcgat
ctggcttatttggagagtgataagttcttgaagaagtgttcgagccttcgggggtcggtg
atgctgatcggtccgatggtggcacgtttcgggaaggcgttgatctcgaagccgggcgga
gataagattggtcgccgtcgtctggacacccactttgtggggattcagaatttgggagct
gacttccgttatgacgagtcgcggggcatctatgagataacggccgacaggcttcaaggc
agctatatgctgcttgatgaagcgtccgtgaccggtacagccaacattctgatggctgcc
gtactggcaaaaggcactaccaccatttacaatgccgcctgcgaaccctacttgcagcag
ctctgccgtatgctcaaccggatgggagcaaagatcagcggcatcgcttccaatctgctc
accatcgagggcgtggaagaactgcacggcacacagcataccgtattgcccgacatgatt
gaagtcgggagcttcatcggcatggctgccatgaccaaaagcgaaataaccattaaaaac
gtttcctacgagaacctcggcatcatccccgaaagtttccgccggttgggcatcaaactg
gagcagaggggagacgatatctacgtccccgcacaggaaacatacgaaatagaatcattc
atcgacggctccatcatgaccattgccgacgccccctggccgggactgacacccgacttg
ctgagcgtgatgcttgtagtggccacccaagccaaaggaagcgtactgatccatcagaag
atgttcgaaagccgcctgttctttgtagacaagctcatcgacatgggggctcagatcatc
ctttgcgaccctcaccgtgccgtagtaatcggacataaccacggcttcaagctgcgcggc
gcccgactgacttcgcccgatatccgtgcggggatcgcccttctcatcgccgccatgagc
gccgaaggaaccagcacgatcagcaatatcgaacagatagaccgtggctaccagaacatc
gaaggacgacttaacgccatcggcgccagaatcactcgaatatga

DBGET integrated database retrieval system