KEGG   Bacteroides thetaiotaomicron: BT_2068Help
Entry
BT_2068           CDS       T00122                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bth  Bacteroides thetaiotaomicron
Brite
Enzymes [BR:bth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     BT_2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2589591..2590352)
Genome map
AA seq 253 aa AA seqDB search
MSIAAFNLFLGVMSLTALIVFIALYFVKAGYGIFRTASWGVAISNKLAWILMEAPVFLVM
CWMWIHSERRFDPVILTFFVFFQIHYFQRAFVFPLLLTGKSKMPLAIMSMGILFNLLNGY
MQGEWIFYLSPEGMYHSGWFTSAWFIAGSLLFFAGMLMNWHSDYIIRHLRKPGDTRHYLP
QKGMYRYVTSANYLGEIIEWAGWAILTCSLSGLVFFWWTVANLVPRANAIWHRYREEFGS
EVGERKRVFPFIY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagctgcctttaatctatttttgggcgtcatgagtctgaccgctctgattgtt
ttcatcgccctctactttgtgaaagccggttacgggatatttcgcaccgcctcctgggga
gttgccatttccaacaagctggcgtggatactgatggaagcccccgtatttctggtcatg
tgctggatgtggatacactcggaacgtcgttttgatccggtcatactgacattctttgtc
ttctttcagattcattattttcagcgcgccttcgtctttcccctgctactgaccggaaag
agtaaaatgccgctggcaatcatgtcgatgggaatcctgttcaatctattgaacggctat
atgcagggtgaatggatattttatctctcacccgagggaatgtatcattccggctggttc
acttccgcatggtttattgcgggcagtctgcttttctttgcgggcatgttgatgaactgg
cattcggactatatcatccgccatttgcgcaaaccgggggatacccgtcattatctgcca
caaaaagggatgtaccgctatgtcacttccgccaattatctgggcgaaatcattgaatgg
gcaggctgggcaatactgacttgttcactatccggacttgtattcttctggtggacagtg
gccaatctcgtcccccgtgccaatgcaatctggcatcgctaccgtgaagaatttggctcg
gaagtaggcgaacgcaaacgtgtatttccttttatctattga

DBGET integrated database retrieval system