KEGG   Bacteroides thetaiotaomicron: BT_2146Help
Entry
BT_2146           CDS       T00122                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BT_2146
Enzymes [BR:bth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BT_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2702646..2705327
Genome map
AA seq 893 aa AA seqDB search
MTVSFNIEYRTSWGEEVRIAGLLPESIPMHTTDGIYWTADVELEVPKEGMTINYSYQIEQ
NQIIIRKEWDSFPRRLFLSGNSKKKYQIKDCWKNIPEQLYYYSSAFTEALLAHPDRAEIP
PCHRKGLVIKAYAPRINKDYCLAICGNQKALGNWDPDKAIPMSDANFPEWQIELDASKLK
FPLEYKFILYHKEEKKADCWENNPNRYLADPELKTNETLVISDRYAYFDIPVWKGAGIAI
PVFSLKSENSFGVGDFGDLKRMIDWAVSTQQKVIQILPINDTTMTHAWTDSYPYNSISIY
AFHPMYADIKQMGTLKDKSAAAKFNKKQKELNGLPAMDYEAVNQTKWEYFRLIFKQEGEK
VLASGEFGEFFNANKEWLQPYAVFSYLRDAFQTPNFREWPRHSVYNAQDIEKMCRPESVD
YPHIALYYYIQFHLHLQLVAATKYAREHGVVLKGDIPIGISRNSVEAWTEPYYFNLNGQA
GAPPDDFSVNGQNWGFPTYNWDVMEKDGYRWWMKRFQKMSEYFDAYRIDHILGFFRIWEI
PMHAVHGLLGQFIPSIPMSREEIESYGLPFREEYLIPYIHESFLGQVFGPHTDYVKQTFL
LPAETPGVYHMKPEFTTQREVESFFAGKNDENSLWIRDGLYTLISDVLFVPDTKEKDKYH
PRIGIQRDFIFRSLNEQEQNAFNRLYDQYYYHRHNEFWRQQAMKKLPQLTQSTRMLVCGE
DLGMIPDCVSSVMNDLRILSLEIQRMPKNPMHEFGYLNEYPYRSVCTISTHDMSTLRGWW
EEDYLQTQRYYNTMLGHYGTAPTVATPELCEEVVRNHLKSNSILCILSLQDWLSIDGKWR
NPNVQEERINVPSNPRNYWRYRMHLTLEQLMKAEELNDKIRELIKYTGRAPKK
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgactgtatcatttaacatcgaatatcgcaccagttggggagaagaagtcaggattgcc
gggctgctgccggagtcgatccccatgcataccacagacggcatatactggacggcagac
gtggaactggaagttcccaaagaaggaatgactatcaattacagctatcagatagaacaa
aaccaaattatcatccgcaaagaatgggacagctttccgagacgtctctttttatccggt
aactctaaaaagaagtatcagattaaagactgctggaaaaatatccccgaacaattgtat
tactacagttcggccttcacggaagccttgttagcccatcccgacagagctgaaattccg
ccttgtcacagaaaagggctggtcatcaaggcatacgccccacgcatcaacaaagactat
tgcctggcaatttgcggaaatcagaaagcattgggaaactgggacccggacaaagcgatt
cccatgagcgatgccaactttccggaatggcagatcgagctggatgcaagtaagctgaaa
ttcccgctggaatacaaattcatcctttaccataaagaagaaaagaaagcggactgctgg
gaaaataaccccaaccgctatcttgccgacccggaactgaaaacaaatgagacgctggtc
atctccgaccgatatgcctatttcgatattccggtatggaaaggggccggtatagccatc
cctgtcttttcactgaaatcagagaacagtttcggagtaggagatttcggagatttgaaa
cgcatgattgactgggctgtaagtacccaacaaaaggttatacagatattaccgatcaat
gatacgaccatgactcatgcgtggaccgattcttatccatataatagtatctccatttat
gctttccacccgatgtatgcagatataaagcagatgggaacactgaaagacaagtcagcc
gcagcgaagttcaacaaaaaacagaaagaactcaacggcctgccggcgatggattatgaa
gctgtcaaccaaacgaaatgggaatacttccgactgatcttcaagcaggaaggagaaaaa
gtattagcctccggagagttcggcgaattctttaatgccaacaaggaatggctgcaacct
tacgctgttttcagctatctgcgcgatgcctttcagacacctaatttccgtgaatggccc
agacattccgtttataatgcacaagatatagagaagatgtgccggccagaatctgtagat
tacccgcatatcgcactttattattatatccagtttcacctgcacctgcaattggtagcc
gctacgaaatacgcccgcgaacacggtgtcgtactcaaaggagatatccctatcggcatc
agccgcaacagtgtggaagcatggaccgaaccttattacttcaatctcaacgggcaggcg
ggcgcccctcccgatgatttctcggtgaacggacaaaactggggattccccacgtacaac
tgggacgtcatggaaaaggacggctaccgctggtggatgaagcgtttccaaaaaatgtca
gagtacttcgacgcttaccggattgaccacatcctcggtttcttccgtatctgggaaatc
ccgatgcatgccgtacacggattactcggacagttcattccctccatccctatgagtcgg
gaggaaatcgaaagttacggactcccctttcgggaagaatatttgattccatatattcat
gaatccttcctcgggcaagtattcggtccgcataccgattatgtgaaacagacttttctg
cttcctgccgaaacacccggtgtttatcacatgaaaccggagttcaccacccaacgggaa
gtggagagtttctttgcaggaaagaatgatgaaaacagtctttggattcgggatggacta
tacactttgatcagtgatgttctttttgtaccggacacgaaagaaaaagataaatatcat
ccgcgcatcggaatacaacgcgatttcatcttccgttcactcaatgaacaggagcagaat
gcgtttaacagactgtatgatcagtattattatcaccgccacaacgagttctggcgccaa
caggctatgaagaaactaccgcaactgacacaatcgacacgtatgctggtttgcggagaa
gacctgggtatgattccggattgtgtttcgtccgtcatgaatgatcttcgtatcctcagt
ctggagattcagcggatgccaaagaatccgatgcacgagttcggatatttaaatgaatac
ccataccggtcggtttgtaccatctccactcatgatatgtctactttgcgaggctggtgg
gaagaagattacctgcagacacagcgttactacaacacgatgctggggcattacggaacc
gcaccgacagtcgccactcccgaattgtgcgaagaagtggtgcgcaatcatctgaaaagc
aattccatactttgtattctgtccctgcaagactggctgagcattgatggcaaatggaga
aatccgaatgtgcaggaagaacggattaatgtaccatccaatccgcgcaattattggcgt
taccggatgcacctcactctggaacagttgatgaaagcagaagaactcaatgacaagata
cgtgagctaataaaatacaccggcagagctcccaagaaataa

DBGET integrated database retrieval system