KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_2401Help
Entry
BT_2401           CDS       T00122                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00260  Glycine, serine and threonine metabolism
bth00750  Vitamin B6 metabolism
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT_2401
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BT_2401
Enzymes [BR:bth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BT_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 1074388
NCBI-ProteinID: NP_811314
UniProt: Q8A543
Position
complement(2996511..2997812)
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPMASLQEAVVKGLAADRGLFMPMTIKPLPQEFYDTIDTLSFQEIAYRVAD
AFFGEDIPTDTLKQIVYDTLSFDVPLVKVADNIYSLELFHGPTLAFKDVGGRFMARLLGY
FIKKEGQKDVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGQNI
TALEVDGTFDDCQALVKAAFMDKELNEHLSLTSANSINVARFLPQAFYYFYAYAQLKRAG
KADNAVICVPSGNFGNITAGLFGKKMGLPVKRFIAANNRNDIFYQYLQTGKYNPRPSVAT
IANAMDVGDPSNFARVLDLYGGSHADISAEISGTTYTDEQIRETVKETWKEHHYLLDPHG
ACGYRALQEGLKQGETGVFLETAHPAKFLETVESIIGEAVEIPAKLQEFMKGEKKSLQMT
KEFADFKKYLLSV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactatagtacaaataaacaagcgccgatggcttctttgcaggaggctgtagta
aaagggcttgccgccgacagaggacttttcatgccaatgactatcaagcctcttccccaa
gaattttacgatacgatagatactttgtcttttcaggagattgcttatcgggtagccgat
gctttctttggcgaagacatccccaccgatacactgaaacaaatagtgtatgacacattg
agctttgatgtaccgttggtgaaagtggcggacaacatctattctctggaacttttccac
ggaccgactctggctttcaaagatgtaggcggccgttttatggcacgtttgctgggttac
ttcatcaagaaagaagggcagaaggatgtgaatgtgctggtagcgacttccggtgatacg
ggaagtgccgttgccaacggttttctgggtgtggaaggtattcatgtatatgtactttac
ccgaaaggaaaagtcagcgaaatacaggaaaagcagttcactactttgggacagaatatt
accgctctcgaagtggacggaacgtttgatgattgccaggcactggtaaaagctgctttc
atggataaggaactgaatgaacatctgtcactgacttccgccaattctatcaatgtagcc
cgcttcctgccgcaagcattctattatttctatgcttatgcacagctgaaacgtgccgga
aaagccgataatgccgtgatttgtgttcctagcggaaacttcggaaacatcacagccgga
ttgttcggcaaaaagatgggcttgcctgtcaaacgttttattgctgccaacaatcgcaac
gatatattctatcaatacctgcaaacaggtaaatataatccccgcccatccgttgcaacc
atagccaacgctatggacgtaggtgatccgagcaactttgcccgtgtgcttgacttgtat
ggcggttctcatgctgacatttctgctgagatttcgggaactacatataccgacgaacag
attcgcgaaacggtgaaagaaacctggaaggaacatcattacctgctcgatcctcatgga
gcttgcggttatcgcgctttgcaagaaggactgaaacaaggcgaaacgggagtcttcctt
gaaactgctcatcctgctaaattcctggaaactgtagaaagtatcattggcgaagcggta
gaaatacctgccaagttgcaggaatttatgaaaggggagaaaaagagcttgcaaatgacg
aaagaatttgcagacttcaagaagtatttgctttctgtttga

DBGET integrated database retrieval system