KEGG   Bacteroides thetaiotaomicron: BT_2401Help
Entry
BT_2401           CDS       T00122                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BT_2401
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT_2401
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BT_2401
Enzymes [BR:bth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BT_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2996511..2997812)
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPMASLQEAVVKGLAADRGLFMPMTIKPLPQEFYDTIDTLSFQEIAYRVAD
AFFGEDIPTDTLKQIVYDTLSFDVPLVKVADNIYSLELFHGPTLAFKDVGGRFMARLLGY
FIKKEGQKDVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGQNI
TALEVDGTFDDCQALVKAAFMDKELNEHLSLTSANSINVARFLPQAFYYFYAYAQLKRAG
KADNAVICVPSGNFGNITAGLFGKKMGLPVKRFIAANNRNDIFYQYLQTGKYNPRPSVAT
IANAMDVGDPSNFARVLDLYGGSHADISAEISGTTYTDEQIRETVKETWKEHHYLLDPHG
ACGYRALQEGLKQGETGVFLETAHPAKFLETVESIIGEAVEIPAKLQEFMKGEKKSLQMT
KEFADFKKYLLSV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactatagtacaaataaacaagcgccgatggcttctttgcaggaggctgtagta
aaagggcttgccgccgacagaggacttttcatgccaatgactatcaagcctcttccccaa
gaattttacgatacgatagatactttgtcttttcaggagattgcttatcgggtagccgat
gctttctttggcgaagacatccccaccgatacactgaaacaaatagtgtatgacacattg
agctttgatgtaccgttggtgaaagtggcggacaacatctattctctggaacttttccac
ggaccgactctggctttcaaagatgtaggcggccgttttatggcacgtttgctgggttac
ttcatcaagaaagaagggcagaaggatgtgaatgtgctggtagcgacttccggtgatacg
ggaagtgccgttgccaacggttttctgggtgtggaaggtattcatgtatatgtactttac
ccgaaaggaaaagtcagcgaaatacaggaaaagcagttcactactttgggacagaatatt
accgctctcgaagtggacggaacgtttgatgattgccaggcactggtaaaagctgctttc
atggataaggaactgaatgaacatctgtcactgacttccgccaattctatcaatgtagcc
cgcttcctgccgcaagcattctattatttctatgcttatgcacagctgaaacgtgccgga
aaagccgataatgccgtgatttgtgttcctagcggaaacttcggaaacatcacagccgga
ttgttcggcaaaaagatgggcttgcctgtcaaacgttttattgctgccaacaatcgcaac
gatatattctatcaatacctgcaaacaggtaaatataatccccgcccatccgttgcaacc
atagccaacgctatggacgtaggtgatccgagcaactttgcccgtgtgcttgacttgtat
ggcggttctcatgctgacatttctgctgagatttcgggaactacatataccgacgaacag
attcgcgaaacggtgaaagaaacctggaaggaacatcattacctgctcgatcctcatgga
gcttgcggttatcgcgctttgcaagaaggactgaaacaaggcgaaacgggagtcttcctt
gaaactgctcatcctgctaaattcctggaaactgtagaaagtatcattggcgaagcggta
gaaatacctgccaagttgcaggaatttatgaaaggggagaaaaagagcttgcaaatgacg
aaagaatttgcagacttcaagaagtatttgctttctgtttga

DBGET integrated database retrieval system