KEGG   Bacteroides thetaiotaomicron: BT_2493Help
Entry
BT_2493           CDS       T00122                                 

Definition
ROK family transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT_2493
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT_2493
   00052 Galactose metabolism
    BT_2493
   00500 Starch and sucrose metabolism
    BT_2493
   00520 Amino sugar and nucleotide sugar metabolism
    BT_2493
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BT_2493
   00524 Butirosin and neomycin biosynthesis
    BT_2493
Enzymes [BR:bth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BT_2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3115362..3116342)
Genome map
AA seq 326 aa AA seqDB search
MNSNMEKPYVVGIDIGGTNTVFGIVDARGTIIASSSIKTAGYPTAAEYADEVCKNLLPLI
IANGGVDKIRGIGVGAPNGNYYTGTIEFAPNLPWKGILPLAAMFEERLGIPTALTNDANA
AAIGEMTYGAARGMKDFIMITLGTGVGSGIVINGQMVYGHDGFAGELGHVIARRDGRVCG
CGRKGCLETYCSATGVARTAREFLAARTDASLLRNIPAENITSKDVYDAAVQGDKLAQEI
FEFTGNILGEALADAIAFSSPEAIVLFGGLAKSGDYIMKPIQKAIDDNILNIYKGKTKLL
VSELKDSDAAVLGASALAWELKDLKE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaacatggagaaaccctacgtagtaggtattgacataggcggaacaaacacc
gtctttgggattgtagacgcacgcggaactattattgccagtagctcgattaaaacagcc
ggctatccgactgctgcagaatatgctgacgaagtatgcaaaaacttgcttccgttgatc
attgctaatggtggtgtagataagatcagaggtatcggtgtcggtgctcctaatggtaac
tattataccggaactattgaatttgctccgaacttgccttggaaaggaattcttccgttg
gctgctatgtttgaagaaagactgggtattcctactgctttgaccaatgatgctaatgct
gctgctatcggtgaaatgacttacggcgctgcccgtggtatgaaagattttattatgatc
actctgggtacaggtgtaggtagcggtatcgttatcaacggtcagatggtttatggccat
gacggttttgccggagaattgggccacgtaattgcacgtcgtgacggtcgtgtttgtggt
tgcggtcgtaaaggttgtctggaaacttactgttcggctaccggtgtagctcgtactgct
cgtgaattcctggctgctcgtactgatgcaagcttgcttcgtaatattcctgctgaaaac
atcacttcaaaagatgtatatgatgcagctgtacaaggtgataaactggcacaggaaatc
ttcgaatttacaggtaatattttaggtgaggctttggcagacgctattgcattctccagc
cctgaagcaattgtattgttcggtggtttggctaagtcgggtgattatattatgaagccg
attcagaaagcaatcgatgacaatatcctgaatatctacaaaggcaagactaaattgctt
gtttccgaactgaaagattctgatgctgctgtactgggtgccagtgctttggcttgggaa
ttgaaagatctgaaagaataa

DBGET integrated database retrieval system