KEGG   Bacteroides thetaiotaomicron: BT_2571Help
Entry
BT_2571           CDS       T00122                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bth00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bth00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bth00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3208980..3209945
Genome map
AA seq 321 aa AA seqDB search
MDKKVTLAQLKEVVQEAYDQVKTNTGGKNADYIPYLANVNKDLFGISVCLLNGQTIHVGD
TDYRFGIESVSKVHTAILALRQYGAKEILDKIGADATGLPFNSIIAILLENDHPSTPLVN
AGAISACSMVQPIGDSAKKWDAIVENVTDLCGSAPQLIDELYKSESDTNFNNRSIAWLLK
NYNRIYDDPDMALDLYTRQCSLGVTALQLSVAAGTIANGGVNPVTKKEVFDASLAPKITA
MIAAVGFYEHTGDWMYTSGIPAKTGVGGGVMGVLPGQFGIAAFAPPLDGAGNSVKAQLAI
QYVMNKLGLNVFSDNHLIVVD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaagtaacactcgctcaattgaaagaagtggtacaggaggcatacgatcag
gtgaaaacgaatacaggcggtaagaatgccgactatatcccttatctggccaatgtcaac
aaagatctctttggaatcagtgtctgcctgctcaacgggcagaccatccatgtgggagat
actgactaccgcttcggcatcgaatccgtatccaaagtacatacggctatccttgcactg
cgccaatatggtgccaaagaaatattagacaagatcggagctgacgcaacgggcctgcct
ttcaattcaatcattgctatcctgctggaaaatgaccatccgtctaccccgttggtaaac
gccggtgccatctccgcctgcagtatggtacaacctatcggcgactctgccaagaagtgg
gatgccatcgtagagaacgtgaccgatttatgcggcagcgctccccagctgattgatgaa
ttgtacaaatccgaatcggatacgaacttcaacaaccgctccattgcgtggttgctgaag
aactacaaccgtatttatgatgatccggatatggcgctggacctgtatacccgccaatgc
tcattgggagtaacggccttgcagctttctgtggcagccggaacaatcgccaacggtggt
gtgaatccggtgacaaagaaagaagtattcgatgccagcctcgctcccaagatcactgca
atgatcgctgccgtaggtttctacgagcatacaggagactggatgtatacctccggcatt
ccggctaaaaccggtgtaggcggtggtgtaatgggcgtattgcccgggcagttcggtatt
gccgcattcgctcctcctttggatggtgcaggcaattcggtaaaagcacaattggctatc
caatatgtcatgaataaactgggactgaatgtattcagtgacaatcacttgatcgtagtc
gactag

DBGET integrated database retrieval system