KEGG   Bacteroides thetaiotaomicron: BT_2851Help
Entry
BT_2851           CDS       T00122                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BT_2851
  Lipid metabolism
   00561 Glycerolipid metabolism
    BT_2851
   00600 Sphingolipid metabolism
    BT_2851
Enzymes [BR:bth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BT_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3557328..3559493)
Genome map
AA seq 721 aa AA seqDB search
MYIMKVRILFLICFLSITCLLNAADKPVIQIHTDNSSLIFRVADNGRLYQSYLGKKLNHE
ADISHLPQGTEAYITHGMEDYFEPAIHILHNDGNPSLLLKYVSHETKAVSQGVNETIITL
GDDKYPVTVKLHYVTYPAEDIIKTYTEISHKEKKPVVLHQYASSMLHLNRAKYYLTEFSG
DWAHEANISDQPLEFGKKVLDTKLGARANMFTPPFFQLSLDQLATENCGEVLVGTLGWTG
NFRFTFEVDNKNELRIISGINPYASEYYLPAGVVFRTPDFYFTYSANGKGKASRNFHDWA
RRYQLKDGDETRMTLLNNWEATYFDFNEEKLIGLIGDAAGLGVDMFLLDDGWFANKYPRS
SDHQGLGDWDETADKLPNGIGRLVEEATKKGIKFGLWIEPEMVNPKSELYEKHKDWVIHL
PNRDEYYFRNQLVLDLSNPKVQDFVFGVVDDLMTKYPGIAFFKWDCNSPITNIYSSYLKE
KQSHLYIDYVRGLYNVLERIKTKYPDLPMMLCSGGSGRIDYETLRYFTEFWPSDNTDPIE
RLFIQWGYSQLFPAKTLCAHVTTWNHDASIKFRTDVAMMGKLGFDIKLSDLNDNEKKFCR
DAVTNYNHLKPVVLEGDMYRLVSPYSGNHTSTQYVGKDKKGAVVFAFDIYSRYGEKLLPV
RLQGLDAGRQYRVKEINLMPGTNSSLQGNGELFSGEYLMTVGLNIFTGQRLNSRVIEVVA
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcatgaaagtgagaatcctttttttaatctgtttccttagtatcacctgtctt
ctgaacgcggcggacaagcctgtcattcagattcatacggataacagtagtctgatcttc
cgcgtagccgacaacgggcggttataccaaagctatctgggcaaaaagctgaaccatgag
gccgatatttctcatcttccgcaagggacggaagcctatatcacccacggtatggaggat
tactttgaacctgccattcatatccttcacaatgacggtaatccgtcacttctgttgaag
tatgtctctcatgagacgaaagcggtgtcgcaaggagttaacgaaaccattatcaccctg
ggagatgataaatatccggttacggtaaagctgcattacgtcacttatcctgccgaggat
atcattaaaacctatacggaaatcagccataaagagaagaagcccgtagtgcttcaccaa
tatgcctctagtatgcttcatctgaaccgtgcgaagtattatctgactgaattttcgggc
gactgggctcacgaagctaatatctccgaccagccgttggagtttggtaaaaaagtgctc
gataccaaactgggcgcccgtgccaacatgtttacccctccgttcttccagctttctttg
gaccagctggctacggagaattgtggtgaagtgctggtaggtacattgggatggaccggc
aatttccgctttactttcgaagtggacaacaagaatgaattgcgtatcatttcgggtatc
aacccttatgcctctgaatattatcttccggcaggtgtcgtgttccgtacccccgatttc
tattttacctatagtgcaaatggtaagggcaaagccagccgtaatttccacgattgggca
cgccgttatcagttgaaggacggagatgaaacccgtatgaccctgttaaataactgggaa
gcgacttatttcgattttaatgaggagaaactgataggactgattggcgatgccgcaggg
ctcggagtggatatgttcttgctggacgacggctggtttgccaataaatatccgcgcagc
agcgatcatcaaggcttgggagactgggatgaaacggcagataaactgcccaacggtatc
gggcgtctggtcgaagaagctacaaagaagggtatcaagttcggtctgtggatagaaccg
gaaatggtgaatccgaagagtgagctttatgagaaacataaagactgggtcatccatctt
cccaatcgggatgaatattacttccgtaatcagttggtacttgacctgagcaatccgaaa
gtgcaggacttcgtatttggagtagtagatgatttgatgactaaatatcccggtattgct
ttcttcaaatgggattgcaatagcccgatcactaatatctactcttcttatctgaaggag
aagcagtcgcacttgtacatcgactatgttcgcggtctgtataatgtactggaacgtatt
aaaacgaagtaccctgatctgccgatgatgctttgttcgggcggtagcgggcgtatcgac
tatgaaacgctcagatacttcactgagttctggccgagtgataacacggaccctatcgaa
cgtctgtttatccaatggggatactctcagcttttcccggcaaaaactctttgtgcacat
gtcactacatggaatcatgatgcaagtatcaaattccgtacagacgtagcaatgatgggc
aaacttggttttgatatcaaattgtcggacctcaatgataatgagaagaagttctgccgt
gatgcggtcaccaactacaatcatcttaaaccggtagtgctcgaaggagacatgtatcgg
ctggtatctccttatagcggaaatcatacttccacacaatatgtggggaaagataagaag
ggagctgttgtctttgcattcgatatttattcccgttatggcgagaaactgttgcctgtc
cgtctgcaaggactggacgccggtcggcagtaccgggtgaaggaaatcaatctgatgccg
ggtactaactcttctctgcaaggaaacggtgagttattctctggtgaatatctgatgacg
gtaggactgaatatatttacaggtcagcgtctgaacagcagagttatagaagtagttgct
gaatga

DBGET integrated database retrieval system