KEGG   Bacteroides thetaiotaomicron: BT_3216Help
Entry
BT_3216           CDS       T00122                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BT_3216
Enzymes [BR:bth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BT_3216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4107989..4108471
Genome map
AA seq 160 aa AA seqDB search
MAKVYISLGTNLGDKEQNLRTAVQKIEEQVGKVISLSAFYITAPWGFDSEHSFLNAAACV
ETELSPLEVLQKTQEIERELGRTHKSVGGVYSDRLIDIDLLLYDDLILSVTSPSGAALNL
PHPLMAERDFVMRPLTEIAPELVHPVLGKAMKVLLAQIEK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagtgtatataagtctcggcactaatctgggagataaagaacagaatctccgg
actgccgtgcaaaagatagaggagcaggtagggaaagtcatttccctgtctgctttttac
atcactgccccttggggattcgattcggagcatagtttcttgaatgcggcggcgtgtgta
gaaacggaactgtcgcctctggaagtactgcagaagacgcaggagatcgaacgggaactg
ggacgtacgcataagtctgtcggtggcgtatatagcgaccggctgattgatatagacctg
ctgctttatgatgatctgatactttcggttacttctccttccggagcagcactcaacctc
ccccaccctttgatggcggaacgtgacttcgtgatgcgccccttaacggagattgccccc
gaactggtgcatccggtattgggaaaggcaatgaaggtgctgctggcgcagatagaaaaa
taa

DBGET integrated database retrieval system