KEGG   Bacteroides thetaiotaomicron: BT_3226Help
Entry
BT_3226           CDS       T00122                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BT_3226
Enzymes [BR:bth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BT_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4117392..4117883
Genome map
AA seq 163 aa AA seqDB search
MKYFCVTEAVALYIQKYVQYRKRKIFFGATGKIEDLVPSIVKHKTEKYLVPMSDVHNDDV
KNLLDKNNIQHTEAVMYRTVSNDFTSDEEFDYDMLVFFSPAGVTSLKKNFPDFDQKEIRI
GTFGSTTAQAVRDAGLRLDLEAPTVQAPSMTAALDMFIKENNK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttctgtgtcacagaagcggttgcattgtacattcagaagtatgtgcaatat
cgcaaacgtaaaatcttcttcggtgctaccggaaagattgaagatttggtgccatctatc
gtaaagcataaaacggagaaatatctcgtccctatgtcggacgtgcacaatgatgatgtg
aaaaacctgctcgacaagaataacatacagcatacagaagctgtaatgtatcgcactgtg
agcaatgactttacatcggatgaggaatttgattatgacatgctcgtgttcttcagccct
gccggagtgacttctttgaagaagaacttcccggactttgaccagaaagagatcagaatc
ggtaccttcgggtcgactaccgcgcaggctgtacgcgacgccggactccgtttggacctt
gaagcaccgactgtgcaggctccgtcaatgacggctgcgcttgatatgttcatcaaggaa
aacaataaataa

DBGET integrated database retrieval system