KEGG   Bacteroides thetaiotaomicron: BT_3312Help
Entry
BT_3312           CDS       T00122                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BT_3312
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BT_3312
Enzymes [BR:bth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BT_3312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4253159..4254649
Genome map
AA seq 496 aa AA seqDB search
MINMRNIALTFLGCFTILAACSNSDDAEKPVVPVPTGDVAIYTTTSSLTRDLTRDAVNFS
PKDNLAPTTITLNPAEQYQTMDGFGAAITGSTCYNLLLMKPADRHAFLTETFSDKDGFGF
SYIRISIGCSDFSLSEYTCCDTKGIENFALQSEEKDYILPILKEILAINPSIKVIAAPWT
CPKWMKVKSLTDRTPLDSWTNGQLNPDYYQDYATYFVKWIQAFKAEGIDIYAVTPQNEPL
NRGNSASLYMEWEEQRDFVKTALGPQMKAAGLSTKIYAFDHNYNYDNIESQKNYPGKIYE
DAAASQYLAGAAYHNYGGNREELLNIHQAYPEKELLFTETSIGTWNSGRDLSKRLMEDME
EVALGTINNWCKGVIVWNLMLDNDRGPNREGGCQTCYGAVDINNSDYKTIIRNSHYYIIA
HLSSVVKPGAVRIATTGYTDNGITCSAFENTDGTYAFVLINNNEKSKKITVSDGQRHFAY
DVPGKSVTSYRWAKSK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatgagaaatatagcactgacctttttaggatgcttcaccatattagcggct
tgtagcaatagtgatgatgcggaaaaaccggtagtacctgtccccaccggagatgtagcc
atttatacgacaaccagcagtctgacccgtgatttgacccgtgatgcggttaacttcagc
ccgaaagacaatttggctccaaccacaataactttgaatcctgcggaacagtaccagacg
atggatggtttcggagcagctatcacaggttctacctgttacaacctgttactgatgaaa
ccggctgaccgtcatgctttcctgacggaaacattctccgataaagatggtttcggattc
agttacatccgtatttccatcggttgttcggacttctcgttaagcgaatatacctgctgt
gatacgaaagggatcgaaaactttgctttgcagagcgaagaaaaggactatatccttccg
atcctgaaagagattctggccattaacccttctatcaaggtaattgccgctccttggacc
tgtccgaaatggatgaaagtgaaaagcctgacagaccgtacaccattggattcgtggacg
aacggacaattgaacccggattattatcaggattatgctacttattttgtgaaatggata
caggcatttaaagccgaaggcattgacatttatgcagtaactccgcaaaatgaacctttg
aaccgtggcaactccgcttcgctctatatggaatgggaagaacaaagagacttcgtgaaa
acagcgctcggtcctcagatgaaagctgccggactgtctaccaagatttatgctttcgac
cataactacaattatgacaatatcgaatcgcagaagaactatccgggcaagatttacgaa
gatgctgctgcttctcagtatctggcaggtgctgcttaccataactatggcggcaaccgt
gaagaattgctgaatatacatcaggcatatcctgagaaagaacttctgtttacagaaact
tctatcggcacatggaacagcggacgtgacttgtcgaagcgtctgatggaagatatggaa
gaggtagcattgggaacaatcaataattggtgtaagggcgtaattgtctggaatctgatg
ctcgataacgaccgtggtccgaatcgtgaaggtggttgtcagacttgctatggtgcggta
gatatcaataacagtgattataagacaatcatacgtaactctcactactatatcattgct
catctttcaagtgttgtgaagccgggagctgtgcgtatcgccactaccggttatacggac
aacggtattacctgttctgctttcgaaaatacggacggaacgtatgcctttgttctgata
aacaacaatgagaagtcgaagaagataactgtcagcgacggccaacgtcattttgcttat
gacgttcccggtaaatcagtaacttcataccgttgggcaaagtcaaagtaa

DBGET integrated database retrieval system