KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_3529Help
Entry
BT_3529           CDS       T00122                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00010  Glycolysis / Gluconeogenesis
bth00052  Galactose metabolism
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT_3529
   00052 Galactose metabolism
    BT_3529
Enzymes [BR:bth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BT_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1072552
NCBI-ProteinID: NP_812441
UniProt: Q8A1X9
Position
4563352..4564485
Genome map
AA seq 377 aa AA seqDB search
MKKLSVWAVAALLMAACTPKAEKTTDSGLLQSNFQMEVDGKKTDLYTLRNKNNMEVCVTN
FGGRIVSVMVPDKDGQMRDVVLGFDSIQDYVSKPSDFGASIGRYANRINQGRFTLDGTEY
QLPQNNYGHCLHGGPQGFQYRVFDAVQPNPQELELTYTAEDGEEGFPGNITCKVLMKLTD
DNAIDIRYEAETDKPTIVNMTNHSYFNLDGDAARNEAHLLTIDADYYTPVDSTFMTTGEI
APVEGTPMDFRTPTPVGARINDYDFVQLKNGNGYDHNWVLNTKGDITRKCATLESPLTGI
VLDVYTNEPGIQVYAGNFLDGSLTGKKGITYNQRASVCLETQKYPDTPNKPEWPSAVLRP
GEKYMSQCIFKFSVNKN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttatctgtatgggcagttgccgccctcttaatggcagcttgtacaccgaaa
gccgagaaaacaacggattccggtttattgcaaagtaacttccagatggaagtggatgga
aagaaaacagatttgtataccttgcgcaacaagaacaacatggaagtttgtgtaacgaac
ttcggtggtcgtatcgtttcagtgatggtacccgacaaggacggacagatgcgtgatgta
gtgctcggcttcgattcgattcaggattatgtcagcaagccttcggacttcggagcaagc
atcggccgttatgctaaccgtatcaaccaaggtcgatttactttggacggtactgagtat
cagttgcctcagaataattacggtcactgcctgcatggcggtccgcaaggattccagtac
cgtgtgtttgatgccgttcagccgaatccgcaagaactggaattgacttacacggcagaa
gatggcgaagaaggtttcccgggaaatatcacttgtaaagtgttgatgaagctgacagac
gataatgcgatcgatatccgttacgaagcggaaaccgacaagccgaccattgtgaatatg
actaaccactcttacttcaatcttgacggagacgcagcccgtaatgaggcgcatctgctg
acaattgatgctgactattatactccggtagacagtaccttcatgactacaggcgagatc
gctccggttgaaggaactccgatggacttccgcactccgactccggtaggcgcacgtatc
aatgactacgatttcgtacagttgaagaatggtaacggttacgatcataactgggtattg
aatactaagggcgacattacccgtaagtgtgctactctcgaatcaccgctgactggtatc
gtactcgatgtatatactaacgaaccgggtattcaggtatatgcaggaaacttcctggat
ggttcgttgaccggaaagaaaggtatcacttacaaccagcgtgcttccgtatgtctcgaa
actcagaagtatcccgatactccgaacaaaccggaatggccttcggcagtacttcgtccg
ggcgagaaatatatgagtcagtgtatctttaagttctctgtaaacaagaattaa

DBGET integrated database retrieval system