KEGG   Bacteroides thetaiotaomicron: BT_3646Help
Entry
BT_3646           CDS       T00122                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bth00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4724545..4725408
Genome map
AA seq 287 aa AA seqDB search
MKLISPTYINVKGRLLDLATPQVMGILNVTPDSFYSGSRMQTQEEIAARARQIIDEGASI
IDIGAYSSRPNAEHITAEEEMNRLRTGLEIVNRNHPDAIVSVDTFRADVAEQCVEEYGVA
IVNDIAAGEMDNRMFETVARLGVPYIMMHMQGTPQNMQKEPHYDNLMKEVFMYFARKVQQ
LRELGLKDIILDPGFGFGKTLEHNYELMAHLEEFSIFELPLLVGVSRKSMIYKLLGGTPQ
DSLNGTTVLDTVALMKGANILRVHDVREAVEAVRIVDKLRTESEYGK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgatctctccaacttatataaatgtgaaaggacgtctgctcgatcttgctact
ccgcaagtgatgggtattctcaatgtgacacccgattctttttattccggcagccggatg
cagacgcaggaggaaattgcagcgagggcacggcagatcatcgatgaaggagcctctatc
attgatatcggagcttactcctcgcgcccgaacgccgaacacatcaccgccgaagaagaa
atgaaccgcttacgtaccggactggagatcgtaaaccggaatcatccggatgctatcgtt
tcggtcgatactttccgggcggatgtagccgaacagtgtgtggaggagtatggcgtagct
atcgtcaatgatatcgctgccggtgagatggacaaccggatgtttgagactgtggcccgc
ctgggagtgccttatatcatgatgcacatgcagggaactccccaaaatatgcagaaagaa
ccccattatgataatttgatgaaggaagtgttcatgtactttgctcgcaaggtgcaacaa
cttcgtgaattgggtctgaaagacattatactcgatccgggttttggttttgggaagaca
ctggagcataattatgagttgatggctcacctggaagagttcagcattttcgaacttcca
ctgttagtcggtgtttcccggaaatcaatgatttataaactattgggaggaactccgcag
gattcattgaatggaacaaccgtactggataccgttgcgttaatgaaaggagcgaacatt
cttcgggtgcatgacgtgcgcgaagcggtggaagccgtccggattgtggataaactgaga
actgagagtgaatatggcaaatga

DBGET integrated database retrieval system