KEGG   Bacteroides thetaiotaomicron: BT_3708Help
Entry
BT_3708           CDS       T00122                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BT_3708
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BT_3708
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BT_3708
Enzymes [BR:bth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BT_3708
Exosome [BR:bth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BT_3708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4818649..4820052)
Genome map
AA seq 467 aa AA seqDB search
MKKLIYTLLFVLISVAANGQQAKYVFYFIGDGMGVNQVNGTEMYQAELQNGRIGVEPLLF
TQFPVATMATTFSATNSVTDSAAAGTALATGKKTYNSAISVGEDKNPIETVAEKAKKAGK
KVGVTTSVSVDHATPAAFYAHQADRNMNYEIAVDLTKANFDFYAGGGFLKPDKTYDKKDA
PNIFPIFEEAGYTVARGYSDYKAKSKDAGKMILIQEEGKDPSCLPYAIDRKSDDLTLAQI
TESAIDFLTKGKNKGFFLMVEGGKIDWACHGNDAATVFNEVKDMDDAIKVAYEFYKKHPK
ETLIVVTADHETGGIVLGTGKYALNLKALQYQKHSADGLSRRISELRKSKGNKVTWEDMK
EFLGEEMGFWKQFPISWEQEKKLRDEFEQSFVRNKVVFAESMYSKSEPMAARAKEVMDQI
SMVGWVSGGHSAGYVPVFAIGAGSQLFGEKIDNTEIPKRIAKAAGYK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttgatttacacactgctctttgtccttatttccgttgcagccaacggtcag
caggcaaagtatgtattctatttcatcggagacggaatgggagtcaatcaggtaaatggt
acagagatgtatcaggcagaactgcaaaacgggcgcatcggcgttgaacctttattgttc
acccaatttccggtagcaacgatggcaaccactttctccgcgacaaactctgttaccgac
tctgccgctgcgggtactgcactggctaccggaaagaagacctacaacagtgccatctct
gtaggagaagacaaaaacccgattgaaaccgtagccgaaaaagccaagaaggccggaaag
aaagtaggtgtcactacttccgtcagcgtagaccacgccactcctgccgctttctacgct
catcaggcagaccgtaatatgaattatgaaatcgctgtcgacctgacaaaagcaaacttt
gacttctatgcaggcggtggttttctgaaaccggacaagacgtatgacaagaaagacgct
cccaacatcttccctattttcgaagaagcaggttacaccgtagcacgtggctacagcgat
tataaagccaaaagcaaggatgccggcaaaatgatcctgatacaggaagaaggcaaagat
ccatcctgcctgccttatgctatcgaccgtaaaagcgacgacttgactctcgcccaaatc
acagaaagcgcaatcgacttcctgaccaaaggcaagaacaaaggattcttcttaatggta
gaaggtggaaagattgactgggcttgccacggtaatgacgccgctaccgtattcaatgaa
gtaaaggacatggatgacgctatcaaagtagcttacgaattctacaagaaacatccgaaa
gaaacactgatcgttgttacggccgaccacgaaaccggtggtatcgtactaggtacaggc
aaatatgcgttgaacctgaaagcattgcaatatcaaaaacattctgctgacggattgtcc
agacgtatcagcgaactaagaaaatcaaaaggcaacaaagtgacttgggaagacatgaaa
gaattcctgggtgaagaaatgggcttctggaaacagttccctatttcctgggaacaggaa
aagaagctgcgtgacgagttcgaacaatcctttgtcagaaataaagtggtatttgccgaa
agcatgtactctaaaagcgagccgatggctgcacgcgctaaagaagtaatggaccagata
tctatggtaggctgggtaagcggcggtcactctgccggttatgtgccggtatttgctatc
ggtgccggttctcaactgttcggtgagaagattgacaatacggaaattccgaaacggata
gctaaagctgccggatataaataa

DBGET integrated database retrieval system