KEGG   Bacteroides thetaiotaomicron: BT_3772Help
Entry
BT_3772           CDS       T00122                                 

Definition
ribosomal large subunit pseudouridine synthase D
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bth  Bacteroides thetaiotaomicron
Brite
Enzymes [BR:bth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BT_3772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4892568..4893239
Genome map
AA seq 223 aa AA seqDB search
MTVVYEDNHIIVVNKTASEIVQADKTGDTPLSETVKQYLKEKYQKPGNVFIGVTHRLDRP
VSGLVIFAKTSKALTRLNEMFRTSEVKKTYWAVVKNAPKEPEGELVHYLARNEKQNKSFA
YDKEVPNSKKAILNYRLIGHSENYYLLEVDLKTGRHHQIRCQLAKMGCPIKGDLKYGAPR
SNPDGSICLHARKVRFIHPVSKELIELEAPLPEGNLWKGFELL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgtatacgaagacaaccatataattgtagtcaacaagaccgcttccgagatt
gtccaggcagacaagacgggcgatacaccgctttcggaaactgtgaagcagtacctgaaa
gagaagtatcagaaacccggaaatgttttcatcggtgtgacacaccggctggaccgcccc
gtaagcggccttgttatttttgccaaaacgagtaaggcactcactcgtctgaacgagatg
ttccgtaccagtgaagtgaaaaagacttactgggcagtagtaaagaatgcccccaaagag
ccggaaggtgaattggtgcattatctggcacgtaacgagaagcagaacaagagttttgct
tatgacaaagaagtgccgaatagcaagaaagcgattctgaattatcggctgatcggacat
tcggagaattactatctgcttgaagtagacttgaaaaccggacgtcatcatcagattcgt
tgccagttggcaaaaatgggatgtcccattaaaggagaccttaaatatggcgctccgcgt
tccaatcccgatggcagtatttgcctgcatgcgcggaaggtacgcttcatccatcccgtg
tcaaaagagctgatagagctcgaagcccctcttcccgaaggaaatttatggaaaggattt
gaactgctttag

DBGET integrated database retrieval system