KEGG   Bacteroides thetaiotaomicron: BT_3820Help
Entry
BT_3820           CDS       T00122                                 

Definition
DNA polymerase III subunit delta
Orthology
K02341  
DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bth00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bth00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bth03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bth03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bth03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4972204..4973328)
Genome map
AA seq 374 aa AA seqDB search
MFFRDVIGQEEIKQRLIQEVSEGRIPHAQLICGPEGVGKMPLAIAYARYISCTNRGETDA
CGVCPSCVKFNKLVHPDVHFVFPIVKSSKGKREVCDDYIADWRPFVLKNPYFNLNHWLRE
MDAENAQAIIYAKESDEILKKLSLKSSEGGFKITILWLPEKMYPVCANKLLKLLEEPPEK
TIFLLVSEAPEMILPTILSRTQRMNVRKIDEPAIDRVLQSKYGIQPADSLSIAHLANGNF
IKALETIHLNEENQLFFDLFVSLMRLSYQRKIREMKLWSEQVAGMGRERQKNFLEYCQRM
IRENFIFNLHQRDLTYMTINEQNFASRFAPFVNERNVIGIMDELSEAQLHIEQNVNAKMV
FFDFSLKMIVLLKQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcagagacgtaatcggacaagaagaaatcaagcaacgactcattcaggaagtg
agtgaagggcgcataccgcatgcccaactgatctgtggccccgaaggagtcggtaagatg
ccgctggctatcgcttatgcccgctacatcagttgcaccaaccggggtgagacggatgcc
tgcggagtatgtccgtcgtgtgtgaaattcaataaactggtacatccggacgtacatttc
gtattccccatcgtgaaaagttctaaaggaaaacgggaagtgtgcgacgactatatcgcc
gactggagaccattcgttctgaagaatccgtacttcaacctgaatcactggctgagagaa
atggatgccgagaatgcacaggccatcatctacgcaaaagagagcgatgaaatcctgaag
aaactcagcctcaaatcgagcgaaggaggattcaagatcacgattctctggttgcccgaa
aagatgtatccggtatgtgccaacaaattattgaaattgctcgaagagccacctgagaaa
actatcttcctgctcgtatcggaagctccggaaatgattctgcctactattctgagccgt
actcaacgcatgaacgtgcgaaaaatagacgaaccggccatcgaccgcgtattgcagtcc
aaatacggtatccagcctgccgacagcctttccattgcccatctggcaaacgggaacttt
atcaaagcactggaaactattcatctgaatgaagagaatcagctcttcttcgacttattt
gtcagcctgatgcgattgtcctatcaacggaaaatcagggaaatgaagctctggagcgaa
caggttgccggcatgggacgtgaacgccagaagaactttctggaatactgccagcgcatg
atccgcgaaaactttatattcaatctccatcagcgtgatctgacatacatgacaatcaac
gaacagaatttcgcctctcgctttgctcctttcgtcaacgaaaggaacgtaataggcatc
atggatgaactaagcgaagcgcaactgcatatagaacaaaatgtaaatgccaagatggta
tttttcgacttctctctgaagatgatcgtactgttgaagcaataa

DBGET integrated database retrieval system