KEGG   Bacteroides thetaiotaomicron: BT_3820Help
Entry
BT_3820           CDS       T00122                                 

Definition
DNA polymerase III subunit delta
Orthology
K02341  
DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BT_3820
   00240 Pyrimidine metabolism
    BT_3820
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BT_3820
   03430 Mismatch repair
    BT_3820
   03440 Homologous recombination
    BT_3820
Enzymes [BR:bth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BT_3820
DNA replication proteins [BR:bth03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BT_3820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4972204..4973328)
Genome map
AA seq 374 aa AA seqDB search
MFFRDVIGQEEIKQRLIQEVSEGRIPHAQLICGPEGVGKMPLAIAYARYISCTNRGETDA
CGVCPSCVKFNKLVHPDVHFVFPIVKSSKGKREVCDDYIADWRPFVLKNPYFNLNHWLRE
MDAENAQAIIYAKESDEILKKLSLKSSEGGFKITILWLPEKMYPVCANKLLKLLEEPPEK
TIFLLVSEAPEMILPTILSRTQRMNVRKIDEPAIDRVLQSKYGIQPADSLSIAHLANGNF
IKALETIHLNEENQLFFDLFVSLMRLSYQRKIREMKLWSEQVAGMGRERQKNFLEYCQRM
IRENFIFNLHQRDLTYMTINEQNFASRFAPFVNERNVIGIMDELSEAQLHIEQNVNAKMV
FFDFSLKMIVLLKQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcagagacgtaatcggacaagaagaaatcaagcaacgactcattcaggaagtg
agtgaagggcgcataccgcatgcccaactgatctgtggccccgaaggagtcggtaagatg
ccgctggctatcgcttatgcccgctacatcagttgcaccaaccggggtgagacggatgcc
tgcggagtatgtccgtcgtgtgtgaaattcaataaactggtacatccggacgtacatttc
gtattccccatcgtgaaaagttctaaaggaaaacgggaagtgtgcgacgactatatcgcc
gactggagaccattcgttctgaagaatccgtacttcaacctgaatcactggctgagagaa
atggatgccgagaatgcacaggccatcatctacgcaaaagagagcgatgaaatcctgaag
aaactcagcctcaaatcgagcgaaggaggattcaagatcacgattctctggttgcccgaa
aagatgtatccggtatgtgccaacaaattattgaaattgctcgaagagccacctgagaaa
actatcttcctgctcgtatcggaagctccggaaatgattctgcctactattctgagccgt
actcaacgcatgaacgtgcgaaaaatagacgaaccggccatcgaccgcgtattgcagtcc
aaatacggtatccagcctgccgacagcctttccattgcccatctggcaaacgggaacttt
atcaaagcactggaaactattcatctgaatgaagagaatcagctcttcttcgacttattt
gtcagcctgatgcgattgtcctatcaacggaaaatcagggaaatgaagctctggagcgaa
caggttgccggcatgggacgtgaacgccagaagaactttctggaatactgccagcgcatg
atccgcgaaaactttatattcaatctccatcagcgtgatctgacatacatgacaatcaac
gaacagaatttcgcctctcgctttgctcctttcgtcaacgaaaggaacgtaataggcatc
atggatgaactaagcgaagcgcaactgcatatagaacaaaatgtaaatgccaagatggta
tttttcgacttctctctgaagatgatcgtactgttgaagcaataa

DBGET integrated database retrieval system