KEGG   Bacteroides thetaiotaomicron: BT_3971Help
Entry
BT_3971           CDS       T00122                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BT_3971
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BT_3971
Enzymes [BR:bth01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BT_3971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5172133..5172675
Genome map
AA seq 180 aa AA seqDB search
MKSFILMVITMVCAISLEAQNKSFYDFNVTTIDGKEFPLSSLKGKKVLVVNVASKCGLTP
QYAKLQELYDKYKDKNFVIIGFPANNFMGQEPGSNEEIAQFCSLKYDVTFPMMAKISVKG
KNMSPLYQWLTEKKLNGKEDAPVQWNFQKFMIDENGNWVGFVAPKESPLSEKIVTWIEQE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcattcatcttaatggttataacaatggtatgtgcaatctctctggaagcgcag
aataagtctttctacgacttcaatgtgaccacgattgatggtaaggaatttccgctttct
tctttgaaaggaaagaaagtgctggtagtaaatgtagcctccaaatgcggactgacgcca
cagtatgccaaactgcaagagctatatgataaatataaggataagaattttgtaatcatc
ggctttcctgccaacaactttatgggacaggaaccgggaagcaatgaagagatcgctcag
ttctgctccttaaagtatgacgttacttttccgatgatggccaagatttccgtcaagggc
aaaaacatgtcgccactttaccaatggctgacggaaaagaaactgaacggcaaagaagat
gcgcccgtccagtggaattttcagaagtttatgattgacgagaacggaaactgggtcggc
tttgtggcccccaaagagagtccgctctcggaaaaaatcgttacttggatagagcaggag
tag

DBGET integrated database retrieval system