KEGG   Bacteroides thetaiotaomicron: BT_4110Help
Entry
BT_4110           CDS       T00122                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BT_4110
   00500 Starch and sucrose metabolism
    BT_4110
Enzymes [BR:bth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BT_4110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5374134..5375744
Genome map
AA seq 536 aa AA seqDB search
MANKNLYGGNPERGWCMVLPGFFSEDIRVDNHAANGRSSKSFISEGRWAKVISQVKKGDY
VFIQFGHNDEKADSARHTDPGTTFDDNLRRFVNETRVKGGIPVLFNSIVRRNFVQPEDAS
IATDARRAPGEQELPKEVNVLYDTHGAYLDSPRNVAKEMGVAFIDMNKITHDLVQGLGPA
ESKKLFMFVEPEKVPAFPKGREDNTHLNVYGARTIAGLTVDAIAKEIPELAKYVRHYDYV
VAQDGTGDFFTVQEAINAVPDFRKNVRTTILVRKGTYKEKIIIPESKINISLIGEDGVVL
TNDDFANKKNVFGENMGTSGSSSCYIYAPDFYAENITFENSAGPVGQAVACFVSADRAFF
KNCRFLGYQDTLYTYGKHSRQYYEDCYIEGTVDFIFGWSVAVFNRCHIHSKRDGYVTAPS
TDQGKKYGYVFYDCRLTADPDVAKVYLSRPWRPYAQAVFIRCELGKHILPEGWHNWGKKE
AEKTVFYAEYDSHGEGANPKARAAFSRQLKNLKGYEMETVLAGEDGWNPLKNDSVK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaaaaatctgtacggtggaaatcccgaacgcggctggtgtatggtgctcccc
ggatttttttcagaagatatacgtgttgataatcatgccgccaatggccgcagttccaaa
agtttcatatctgaaggccgatgggcaaaagtgatttcccaggtaaagaagggagattat
gtctttatccagttcggacacaatgatgaaaaggctgattctgcacgccatactgatccg
ggaacgacctttgatgacaatctccgtcgtttcgtcaatgaaactcgtgttaaaggaggg
attcctgtgttgttcaactccattgttcgtcgtaattttgtacagccggaagatgcctcg
attgccacagatgcccgtcgtgctccgggtgaacaggaactgccgaaagaagtaaacgtc
ttgtacgatacgcacggtgcctaccttgattctccgcgtaatgtggcaaaagagatggga
gtggcgtttatcgatatgaacaaaattacccatgatctggtgcagggactgggccccgca
gaatcgaagaagttgtttatgtttgtcgaacctgagaaagttccggcttttccgaaaggc
cgggaggataatacccatttgaatgtgtacggagcacggactatcgccgggctgactgta
gatgctatcgcaaaggaaataccggaactggcaaaatatgtccgtcattatgattacgta
gtggcacaagacggaacaggtgatttcttcacagtgcaggaagcgataaatgcagtaccc
gattttcgcaagaatgtgcgtactactatcttggtccgtaaaggcacttataaagagaag
attattattccggaatccaaaataaatatctctctgataggagaggatggtgtggtactg
acaaatgatgactttgccaataagaaaaatgtgtttggtgagaatatgggaacttcggga
tcgtcgagttgctacatttatgctcccgatttctatgcggagaacatcacttttgaaaac
tcggcaggaccggtaggacaggctgttgcctgttttgtatctgccgaccgtgcgttcttt
aagaattgtcgttttctcggttatcaggataccctttatacgtatggcaagcacagccgt
caatattacgaggattgctatatcgaaggaacggttgactttatcttcggatggtctgta
gctgtattcaatcgttgtcatattcatagcaaacgtgatggttatgtgacggcaccctct
acagatcaaggcaaaaagtatggatatgtcttttatgattgccggttgactgctgatccg
gatgttgccaaagtatatctgtctcgtccgtggcgtccgtatgcacaggctgtatttatc
cgttgtgaactggggaaacatatccttccggaaggctggcacaactggggaaagaaagaa
gcggagaaaaccgtattttatgccgaatacgatagtcatggcgagggagccaatccgaaa
gcccgcgcagctttctctcgtcaactgaagaatctgaaaggctacgagatggaaacggtt
ttggcaggtgaagacggctggaatccgctaaagaacgattctgttaaataa

DBGET integrated database retrieval system