KEGG   Bacteroides thetaiotaomicron: BT_4152Help
Entry
BT_4152           CDS       T00122                                 

Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bth00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5452139..5455099
Genome map
AA seq 986 aa AA seqDB search
MALTLWSVMTIFAGETAYLFSYFINDSKDGLHLAYSYDGLNWTPLNGGRSFLAPSVGKDK
LMRDPSICQAPDGTFHMVWTSSWTDRIIGYASSRDLIHWSEQQAIPVMMHEPEAHNCWAP
ELFYDEPSETYYIFWATTIPGRHKEVPTSESEKGLNHRMYYVTTKDFRTFSKTKMFFNPD
FSVIDAAIVKDPTQGDLIMIVKNENSNPPEKNLRVTRTKNIAKGFPTKVSAPITGKYWAE
GPAPLFVGDALYVYFDKYRDHRYGAVRSLDHGETWEDVSDQVSFPKGIRHGTAFAVDASV
VESLVDDRKHQSVKAQTSSWFNDKELTLTGVYYYPEHWDESQWERDFKRMHELGFEFTHF
AEFAWAQLEPEEGRYDFAWLDKAVALAAKYDLKVIMCTSTATPPVWMSRKYPEILLKNED
GTVLDHGARQHASFASPLYRELSYKMIEKLAQHYGNDSRIVGWQLDNEPAVQFDYNPKAE
QAFRDYLRAKYNHNIQLLNDAWGTAFWSEAYSSFDEITLPKRVQMFMNHHQILDYRRFAA
AQTNDFLNEQCLLIRKYAKNQWITTNYIPNYDEGHIGGSPALDFQSYTRYMVYGDNEGIG
RRGYRVGNPLRIAWANDFFRPIQGTYGVMELQPGQVNWGSINPQPLPGAVRLWMWSVFAG
GSDFICTYRYRQPLYGTEQYHYGIVGTDGVTVTPGGREYETFIKEIRELRKHYAPRETKP
ADYLARRTAILFNHENSWSIERQKQNRTWDTFAHIEKYYRTLKSFGAPVDFVSEQKELTE
YPVVIAPAYQLADKELVNKWIAYVKNGGNLVLTCRTAQKDRYGRLPEAPFGSMITPLTGN
EMNFYDLLLPEDPGTVVMNGKQYEWNTWGEILIPASDSQVWATYANEFYEGGPAVTFRKL
GKGTVTYVGVDSHNGALEKDILKKLYAQLQIPVMDLPYGITVEYRNGLGIVLNYSDRSYT
FDIPEGSKVLVGTEEIPTAGVLVFSM
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atggctttaactctttggtcggtaatgacaatctttgcaggtgagactgcttatctcttt
tcttattttatcaatgacagcaaggacggtctgcatcttgcctacagttatgatgggctg
aactggactcctttgaacggcggacgctcttttttggctccgtctgtcggtaaagataaa
ttgatgcgtgatcccagtatatgccaagctcccgacggaacatttcacatggtctggact
tccagttggacggaccggatcatcggatatgcttcttcccgtgatttgattcattggagt
gagcaacaggctattcccgtgatgatgcacgagccggaagctcataattgttgggcgccg
gaactcttttatgacgagccttcggaaacatattacattttttgggcgaccaccatcccc
gggcgccacaaggaagtgcctaccagcgaaagcgaaaaaggactgaaccatcgtatgtac
tatgtcacaacgaaggattttcgtactttctcaaagacgaagatgtttttcaatcccgat
ttcagtgtgatcgacgcggctatcgtgaaagatccgacacagggggatctgatcatgatc
gtcaagaacgagaactccaatcctccggagaaaaacctgcgtgtgacacgcacgaagaat
attgccaaaggttttccgacaaaggtatccgccccgattacgggaaaatattgggcggaa
ggaccggcacctctttttgtgggtgatgcgctttatgtgtattttgataagtatcgtgat
catcgttacggagctgtccgttcgctggatcatggtgaaacgtgggaagatgtatccgat
caggtttcgtttccgaagggaatccgccacgggactgcctttgcggtagatgcttccgtc
gtagagtctctggtagatgaccggaagcatcaatctgtaaaagcacaaacttcttcctgg
ttcaacgataaggaactgacattgacaggagtttattattatcccgaacactgggatgaa
agtcagtgggaacgtgatttcaagaggatgcatgaactgggatttgagtttactcacttt
gcggagtttgcatgggcgcagctggagccggaagaaggacgatacgattttgcctggctg
gataaagcagtagctcttgctgccaaatatgatctgaaagtcattatgtgtacttcgact
gccacacccccggtgtggatgagccggaagtatcccgaaatcctgttgaagaatgaagat
ggtacggttctcgatcacggtgcccgccagcatgcctcatttgcttcgccgctctatcgg
gaattatcgtataagatgatcgagaaactggcacagcattatggcaatgattcccgtatt
gtcggatggcaactcgacaatgaacctgccgtacagttcgactataatccgaaagcggaa
caggctttccgtgattatctccgtgcaaaatacaatcacaacattcagttgctgaacgac
gcgtggggaaccgctttctggagtgaggcttattcgtcttttgatgaaatcactcttcct
aagcgtgtccagatgtttatgaatcatcatcagattctggattatcgtcgttttgccgct
gcgcagaccaatgattttctgaatgaacaatgtctgctgatcagaaaatatgcaaagaac
cagtggattactaccaactatatccccaactatgatgaaggacatatcggcggtagtcct
gcactcgatttccagagttatacacgctatatggtgtatggcgataacgaaggtatcgga
cgccgtggatatcgggtaggaaatccgttgcgtattgcatgggcgaatgacttcttccgt
cctatacagggtacgtatggcgtgatggagttgcaaccgggacaagtgaattgggggagc
attaatccgcaaccgcttccgggagctgtccgtctgtggatgtggagtgtatttgccggt
ggaagcgattttatctgtacgtatcgctatcgccagccgctgtacggcacagagcagtat
cattatgggatagtaggaacggacggcgtaaccgtcactcccggcggaagggaatatgaa
acctttataaaagagataagagaactccggaaacattatgctccgcgcgaaacgaagcct
gccgactatctggcacgtcgtaccgctatccttttcaaccacgagaattcctggagcatc
gagcggcagaaacagaaccgtacatgggatacttttgcacatatagagaagtattaccgg
actttgaagtcatttggtgctcccgttgattttgtctccgaacagaaggagttgacggag
tatcctgtggtgatagctcctgcttaccaactggctgataaggaattagtaaataaatgg
attgcctatgtgaaaaatggtggtaatcttgtgttgacctgccgtacagcacagaaagac
cgttatggccgtttgccggaagctcctttcggttctatgatcacacctctgacgggaaat
gaaatgaacttttatgatctgctgttaccggaagatccgggtactgttgtcatgaatgga
aagcaatatgagtggaatacatggggagaaatactgattcccgcatctgattcgcaggtt
tgggcgacgtatgccaatgaattctatgaaggtggtcctgctgtcacgttccgaaaactg
ggtaaaggcactgttacatatgtcggagttgacagccacaatggtgcgttggaaaaggat
atcttaaagaaattatatgcacagctacagattcctgtgatggatttgccttatggaata
acggtggaataccggaacgggctggggattgtactgaattattcagatcgttcttataca
ttcgacataccggagggaagtaaggtgctggtaggaactgaagagatcccaaccgcagga
gtactggtgttttcaatgtaa

DBGET integrated database retrieval system