KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_4654Help
Entry
BT_4654           CDS       T00122                                 

Definition
(RefSeq) ROK family transcriptional repressor
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00010  Glycolysis / Gluconeogenesis
bth00052  Galactose metabolism
bth00500  Starch and sucrose metabolism
bth00520  Amino sugar and nucleotide sugar metabolism
bth00521  Streptomycin biosynthesis
bth00524  Neomycin, kanamycin and gentamicin biosynthesis
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01120  Microbial metabolism in diverse environments
bth01130  Biosynthesis of antibiotics
bth01200  Carbon metabolism
Module
bth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT_4654
   00052 Galactose metabolism
    BT_4654
   00500 Starch and sucrose metabolism
    BT_4654
   00520 Amino sugar and nucleotide sugar metabolism
    BT_4654
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BT_4654
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BT_4654
Enzymes [BR:bth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BT_4654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-GeneID: 1072476
NCBI-ProteinID: NP_813565
UniProt: Q89YS7
Position
complement(6089786..6090739)
Genome map
AA seq 317 aa AA seqDB search
MEKEYAIGIDLGGTSVKYALIDNNGVFHFQGKLPSNADVSAEAVIGQLVKAVNEVKTFAE
AKRYTIAGIGIGTPGIVDCTNRIVLGGAENIQGWENLKLADRMEKETGLPTQLGNDANLM
GLGETMYGAGNGATHVVFLTVGTGIGGAVIIDGKLFNGYANRGTELGHVPLIANGEPCAC
GSIGCLEHYASTAALVRRFSKRIAEAGISYPNEEINGELIVRLYKQGDKIAAESLNEHCD
FLGHGIAGFINIFSPQRVVIGGGLSEAGDFYIQKVSEKALRYAIPDCAVNTEIMAASLGN
KAGSIGAASLFLNRKPN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaatacgctataggaattgatcttggcgggacttctgtgaaatacgctctt
attgataataatggcgtatttcactttcaagggaagctaccgtcgaatgccgacgtatca
gccgaagctgtcatcgggcaattagtcaaggcagtcaatgaagtgaaaacctttgccgaa
gcaaagaggtatacaatagccggtatcgggatagggacgccgggaattgtcgattgtacg
aatcgtatcgtattgggaggtgcggagaatattcaaggctgggaaaatctgaaactggca
gaccggatggaaaaagagaccggacttcctacccaactgggaaatgacgctaatctgatg
ggacttggcgaaacgatgtacggagccggaaacggagccactcatgtggtctttctgact
gtaggaaccggtatcggtggcgcagtcataattgacggcaaactgtttaacggatacgcc
aatagaggtactgaattgggacatgtccccttgatagctaatggtgaaccttgcgcctgc
ggttcaataggatgccttgaacattatgcttccactgccgcactggtccgtcgtttcagc
aaacggatagccgaagccggcatctcttatccgaatgaagaaataaacggagaattgatc
gtccgtctctataaacaaggagataagattgcggctgagtcgctgaacgaacattgtgat
ttcctcggtcacggcattgccggatttattaatatcttcagccctcaaagagtcgttatc
ggcggaggactgtccgaagccggagacttttatattcagaaagtaagtgagaaagccctt
cgctatgccatccccgactgtgccgtgaacacggaaatcatggcagcctctttaggcaac
aaagccggaagtatcggtgccgcctccctctttttaaatagaaaaccgaattaa

DBGET integrated database retrieval system