KEGG   Bacteroides thetaiotaomicron: BT_4664Help
Entry
BT_4664           CDS       T00122                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BT_4664
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT_4664
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BT_4664
Enzymes [BR:bth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BT_4664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6111641..6113011)
Genome map
AA seq 456 aa AA seqDB search
MSDKRKRYILPEEEIPHYWYNIQADMVNKPMPPLHPGTKQPLKAEDLYPIFAKELCHQEL
NQTDAWIEIPEDVREMYKYYRSTPLVRAYGLEKALGTPAHIYFKNESVSPIGSHKLNSAL
AQAYYCKEEGVTNVTTETGAGQWGAALSYAAKVFGLEAAVYQVKISYEQKPYRRSIMQTF
GAQVTPSPSMSTRAGKDILTAHPTYQGSLGTAISEAIELAQMTPNCKYTLGSVLSHVTLH
QTIIGLEAEKQMEMAGEYPDVVIGCFGGGSNFGGISFPFMRHNILEGKKTRFVAAEPASC
PKLTRGKFQYDFGDEAGYTPLLPMFTLGHNFAPAHIHAGGLRYHGAGVIVSQLLKDNLME
AVDIQQLESFEAGCLFAQAEGIIPAPESSHAIAAAIREAKACKETGEEKVILFNLSGHGL
IDMASYDKYLAGDLVNYALTDEDIQKNLDEIGDLSK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaaaagaaaacggtatatcctaccggaagaagaaattccacattactggtac
aacattcaggctgatatggtgaacaagccaatgccgccgttgcacccgggaacaaaacag
ccgctgaaagcggaagatctgtatccaatctttgccaaagaactgtgtcatcaggagctt
aaccagactgacgcatggatcgaaataccggaagatgtacgcgaaatgtataaatattat
cgcagtacgccgcttgtacgcgcttacggactggaaaaagcgctcggaactccggcacat
atctatttcaagaacgaaagtgtcagcccgatcggttctcataaactgaactctgcgctg
gctcaggcatattattgcaaagaagaaggcgtcacgaacgttactaccgaaaccggtgcg
ggccaatggggagccgccctttcttatgctgccaaagtttttggtctcgaagccgctgtt
tatcaggtaaagatcagctacgaacaaaagccttaccgccgcagcattatgcagactttc
ggcgcgcaggtcactccttctccgtctatgtctacccgtgcgggaaaagatatcctgacg
gctcaccccacctatcagggttctctgggtacagccatctcggaagctatcgaacttgca
caaatgactcccaactgtaaatacactcttggttcggtactcagccacgttactctccac
caaaccattatcggtctggaagctgaaaagcaaatggaaatggcgggcgaatatccggac
gtagtaatcggttgtttcggaggcggttccaacttcggaggtatctctttcccattcatg
cgtcacaacatcctggaaggaaagaaaacgcgtttcgttgctgccgaacctgcttcgtgc
ccgaagctgacccgcggtaaattccaatatgacttcggtgatgaagccggatatactccg
ctgctcccgatgtttacattaggacacaacttcgctcctgcccatatccatgcaggcggt
cttcgctatcacggtgcaggcgtcatcgtctcccaattgctgaaagacaatctgatggaa
gcggtagatatccagcaactggaatctttcgaagccggctgtctgttcgcacaggcggaa
ggtattattccggcaccggaatccagccacgcgattgctgccgctatacgcgaagcaaag
gcgtgcaaggaaacaggagaagagaaagtgattctgttcaacctgtccggacacggtctg
atcgatatggcatcttatgacaaatatctggcaggcgatttagtgaactacgcactgact
gacgaagatattcagaagaatctggatgaaataggagacttatccaagtaa

DBGET integrated database retrieval system