KEGG   Burkholderia thailandensis 2003015869: DR62_2980Help
Entry
DR62_2980         CDS       T03763                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:btha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR62_2980
   00630 Glyoxylate and dicarboxylate metabolism
    DR62_2980
   00640 Propanoate metabolism
    DR62_2980
   00650 Butanoate metabolism
    DR62_2980
  Lipid metabolism
   00071 Fatty acid degradation
    DR62_2980
   00072 Synthesis and degradation of ketone bodies
    DR62_2980
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR62_2980
   00310 Lysine degradation
    DR62_2980
   00380 Tryptophan metabolism
    DR62_2980
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR62_2980
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR62_2980
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DR62_2980
Enzymes [BR:btha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR62_2980
Exosome [BR:btha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR62_2980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1:complement(2998148..2999329)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVICAVLERAGVKPEQVSEVILGQVLTAG
SGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGVTAENVAKEYGITREAQDQFAA
LSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRHGVTAESLASLKPAFAKDG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgaccgtgatctgcgcggtgctcgagcgt
gcgggcgtgaagcccgagcaggtcagcgaagtgattctcggccaggtgctgacggcgggc
tcgggccagaatccggcgcgtcaggcgctcatcgcggcggggctgccgaacgccgtgccg
ggcatgacgatcaacaaggtgtgcggctccggcctgaaggccgtgatgctcgccgcgaac
gcgatcgtcgcgggcgacgcggagatcgtcgtcgcgggcgggcaggagaacatgagcgcc
gcgccgcacgtgctgccgggctcgcgcgacggcttccggatgggcgatgcgaagcttgtc
gacagcatgatcgtcgacggcctgtgggacgtctacaacaagtaccacatgggcgtcacg
gcggagaacgtcgcgaaggagtacgggatcacgcgcgaagcgcaggaccagttcgcggcg
ctgtcgcagaacaaggcggaagccgcgcagaaagccggccgtttcgacgacgagatcgtg
ccgatcgagatcccgcagcgaaagggcgagccgcttcgcttcgcgaccgacgagttcgtg
cgccacggcgtgacggccgagtcgctcgcgagcctgaagcccgcgttcgcgaaggacggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tctgcgaagaaggccgaggcgctcggtctcgagccgctcgcgcggatcaaggcgtacgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggccccgttccggcatcgcgccgctgt
ctcgagcgcgcgggctggtcggtgggcgacctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggtccacaagcagatgggctgggatacgtcgaaggtcaacgtg
aacggcggcgcgatcgcgatcggccatccgatcggcgcgtcgggctgccggattctcgtc
acgctgctgcacgaaatgcaaaagcgcgatgcgaaacgcggcctcgcgtcgctttgcatc
ggcggcggaatgggcgtcgcgctcgcgctcgagcgcccgtaa

DBGET integrated database retrieval system