KEGG   Burkholderia thailandensis E254: BTN_2835Help
Entry
BTN_2835          CDS       T03380                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bthe  Burkholderia thailandensis E254
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bthe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTN_2835
   00630 Glyoxylate and dicarboxylate metabolism
    BTN_2835
   00640 Propanoate metabolism
    BTN_2835
   00650 Butanoate metabolism
    BTN_2835
  Lipid metabolism
   00071 Fatty acid degradation
    BTN_2835
   00072 Synthesis and degradation of ketone bodies
    BTN_2835
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTN_2835
   00310 Lysine degradation
    BTN_2835
   00380 Tryptophan metabolism
    BTN_2835
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTN_2835
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTN_2835
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTN_2835
Enzymes [BR:bthe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTN_2835
Exosome [BR:bthe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTN_2835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1:complement(3192766..3193947)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERAGVKPEQVSEVILGQVLTAG
SGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGVTAENVAKEYGITREAQDQFAA
LSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRYGVTAESLASLKPAFAKDG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgaccgtgatccgcgcggtgctcgagcgt
gcgggcgtgaagcccgagcaggtcagcgaagtgattctcggccaggtgctgacggcgggc
tcgggccagaatccggcgcgtcaggcgctcatcgcggcggggctgccgaacgccgtgccg
ggcatgacgatcaacaaggtgtgcggctccggcctgaaggccgtgatgctcgccgcgaac
gcgatcgtcgcgggcgacgcggagatcgtcgttgcgggcgggcaggagaacatgagcgcc
gcgccgcacgtgctgccgggctcgcgcgacggcttccggatgggcgatgcgaagcttgtc
gacagcatgatcgtcgacggcctgtgggacgtctacaacaagtaccacatgggcgtcacg
gcggagaacgtcgcgaaggagtacgggatcacgcgcgaagcgcaggaccagttcgcggcg
ctgtcgcagaacaaggcggaagccgcgcagaaagccggccgtttcgacgacgagatcgtg
ccgatcgagatcccgcagcgaaagggcgagccgcttcgcttcgcgaccgacgagttcgtg
cgctacggcgtgacggccgagtcgctcgcgagcctgaagcccgcgttcgcgaaggacggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tctgcgaagaaggccgaggcgctcggtctcgagccgctcgcgcggatcaaggcgtacgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggccccgttccggcatcgcgccgctgt
ctcgaacgcgcgggctggtcggtgggcgacctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggtccacaagcagatgggctgggatacgtcgaaggtcaacgtg
aacggcggcgcgatcgcgatcggccatccgatcggcgcgtcgggctgccggattctcgtc
acgctgctgcacgaaatgcaaaagcgcgatgcgaaacgcggcctcgcgtcgctttgcatc
ggcggcggaatgggcgtcgcgctcgcgctcgagcgcccgtaa

DBGET integrated database retrieval system