KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch0150Help
Entry
H175_ch0150       CDS       T02474                                 

Definition
(RefSeq) Arginase (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    H175_ch0150
  Amino acid metabolism
   00220 Arginine biosynthesis
    H175_ch0150
   00330 Arginine and proline metabolism
    H175_ch0150
Enzymes [BR:btht01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     H175_ch0150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161307..162200
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEIDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatctcagttattggagttccaatggatttagggcagatgcgtcgtggc
gttgatatgggaccgagcgcaatccgttatgcaggggtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagagatagatgaa
aatacaaaattaagaaaccttacacaagttgcaactgtatgtaatgaattagcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatt
gctatcggtacattagctggtgtagcaaaacattataaaaacttaggtgttatttggtat
gatgcacacggtgatttaaatacagaggaaacttcaccatctggaaatattcacggtatg
tcacttgcagcaagtttagggtatggacattcttcacttgtagatttatatggagcatat
ccaaaggtgaaaaaagagaatgtcgtaattatcggtgcgcgtgcattggatgaaggagaa
aaagatttcattcgcaatgaaggtattaaagtgttctcaatgcatgaaattgatcgtatg
gggatgacggctgttatggaagaaacaatcgcatatttatctcatactgatggtgtacac
ttatcattagatttagatggtcttgatcctcatgatgcaccaggtgttgggacgcctgta
attggtggtctatcttatcgtgaaagccacttggcgatggaaatgttagcagaagcggat
attatcacatctgctgaatttgttgaggtaaatacgattttagatgagagaaatagaacg
gcaacaacagcagttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system