KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch0594Help
Entry
H175_ch0594       CDS       T02474                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H175_ch0594
Enzymes [BR:btht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     H175_ch0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676274..677170
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGNDDYGTVVRKNLENERIFIDYVVPVTDGTTGIAHIVLAEEDNSIVVVQGANALVNKSV
VDRSKDLLIKADMVVLQLEIPLETVKYVLAICEEHNIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRNRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagcatttcaatggacttagtggctgtttcaaaaaaa
cggccgaaagcaggagaaacagtaattggtgaagcgtttcatacaatccctggagggaaa
ggggcgaaccaagcggttgctgcagctagattaggagcaaatgtagcaatggttggagcg
gtaggaaatgatgattacggaacggtagttagaaaaaatttagagaacgaacgtattttt
atcgactatgtggtaccggttacagatggaacgacaggaattgctcatatcgttttagca
gaagaagataacagtattgttgtcgtacaaggagcaaatgctcttgtaaataagtcagtt
gtagatcgctcaaaagaccttcttataaaagcagatatggttgttctgcaactagaaatt
ccacttgaaacagtaaaatatgtattggctatttgtgaggagcataatattccagttatg
ttaaatccagcgccagcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acgccaaatgaacatgagtgccgcattgtattagatgattttacatcaccaattgaagat
ttattggcgaagtatccaaataaattattgatgacagaaggttctaacggtgttcgtttc
cataatggaacggagattgtacatgttcctagcattgctgttgatgtagtggatacaact
ggagctggtgatacatttaatggtgcgttagcagttgcactttctgaaggagagacactt
caaaaagcaattcgtttcgcgaatattgccggtggtctttctgtaacgaaacttggggca
cagggcggtatgccaacgagaaatcgagtacgtgaagtgcaggtgattgttggatga

DBGET integrated database retrieval system