KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch1078Help
Entry
H175_ch1078       CDS       T02474                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H175_ch1078
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H175_ch1078
Enzymes [BR:btht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     H175_ch1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146148..1147425
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQENWELDERWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSDDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTNAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFAEAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagaaaactgggaattagatgagcgttggaaa
ggaatcacacgtccatattcggcagaagatgtaattcgcctgcgcggatcgattgatatt
gaacatacattagcgcgccgcggtgcggagaagctttggacatcgcttcatacagaagac
tatattaacgcacttggcgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcgatttacttaagtggttggcaagtagcagctgatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtgaaacgaatt
aatcaaacgcttcaacgtgcggatcaaattcagcatatggaaggaagcgatgatacagac
tatttcgtaccgattgtagcagatgcagaagctggatttggcggacaattaaacgtattc
gaactgatgaaaggtatgattgaagcaggtgcatcaggtgtgcattttgaagatcaatta
tcttcagagaaaaaatgtggccatttaggcggaaaagtactactaccaacgcaaacagca
gtacgcaatttaatttctgcacgtcttgcagcagatgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagctgatttaattacgagcgatatcgatcctgttgat
aaagcatttattacaggagaaagaacaccagaaggattttaccgtacgaatgcaggtctt
gatcaagcaattgcgcgtggtttagcgtatgcaccgtatgcagacctcgtttggtgtgaa
acgtcggaaccaaatttagaagatgcaaaacgatttgcggaggcaattcataaggagcat
ccaggaaagctacttgcatataactgttcaccttcattcaactggaaacaaaaactagat
gaaaaaacaattgcgagcttccaaaaggaaatcgcatcttacggttataagttccaattc
gtaacgcttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgcagctgaaaaa
cacggctactctgcaacacgtcaccaacgcgaagtaggaacaggttactttgatgaagtg
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaagggtctacggaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system