KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch1078Help
Entry
H175_ch1078       CDS       T02474                                 

Definition
(RefSeq) Isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H175_ch1078
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H175_ch1078
Enzymes [BR:btht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     H175_ch1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146148..1147425
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQENWELDERWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSDDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTNAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFAEAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagaaaactgggaattagatgagcgttggaaa
ggaatcacacgtccatattcggcagaagatgtaattcgcctgcgcggatcgattgatatt
gaacatacattagcgcgccgcggtgcggagaagctttggacatcgcttcatacagaagac
tatattaacgcacttggcgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcgatttacttaagtggttggcaagtagcagctgatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtgaaacgaatt
aatcaaacgcttcaacgtgcggatcaaattcagcatatggaaggaagcgatgatacagac
tatttcgtaccgattgtagcagatgcagaagctggatttggcggacaattaaacgtattc
gaactgatgaaaggtatgattgaagcaggtgcatcaggtgtgcattttgaagatcaatta
tcttcagagaaaaaatgtggccatttaggcggaaaagtactactaccaacgcaaacagca
gtacgcaatttaatttctgcacgtcttgcagcagatgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagctgatttaattacgagcgatatcgatcctgttgat
aaagcatttattacaggagaaagaacaccagaaggattttaccgtacgaatgcaggtctt
gatcaagcaattgcgcgtggtttagcgtatgcaccgtatgcagacctcgtttggtgtgaa
acgtcggaaccaaatttagaagatgcaaaacgatttgcggaggcaattcataaggagcat
ccaggaaagctacttgcatataactgttcaccttcattcaactggaaacaaaaactagat
gaaaaaacaattgcgagcttccaaaaggaaatcgcatcttacggttataagttccaattc
gtaacgcttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgcagctgaaaaa
cacggctactctgcaacacgtcaccaacgcgaagtaggaacaggttactttgatgaagtg
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaagggtctacggaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system