KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch1456Help
Entry
H175_ch1456       CDS       T02474                                 

Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H175_ch1456
Enzymes [BR:btht01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     H175_ch1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1489196..1489765
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKAK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcgatt
ggggatgatccaaatcgtgagggagtacttgatacgccaaagcgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagagcatttgcataaagtattcgga
gaagatcacgaagagcttgtactagtaaaagatataccattttattcgatgtgtgagcat
catttagttccattctatggagttgctcacgttgcatatattccgcaaggtggaaaggtg
acagggttaagtaaattagctcgtactgtagatacaattgcacgtcgtccacaactgcaa
gaacgtattacatcaacagtagccaactctattatggaagtactagagcctcatggtgta
atggtagtagtagaagcagaacatatgtgtatgacgatgcgtggtgtgaaaaaaccaggt
gcgaaaacagtaacgacagcagtgcgtggtgtgcttgaaaatgatgctgcagcgcgcagt
gaaattttatcgtttattaaagcgaagtaa

DBGET integrated database retrieval system