KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch2113Help
Entry
H175_ch2113       CDS       T02474                                 

Definition
(GenBank) Uroporphyrinogen-III methyltransferase / Uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00860  Porphyrin and chlorophyll metabolism
btht01100  Metabolic pathways
btht01110  Biosynthesis of secondary metabolites
btht01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H175_ch2113
Enzymes [BR:btht01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     H175_ch2113
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     H175_ch2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: AGG00826
UniProt: M1QEH0
Position
complement(2097708..2099132)
Genome map
AA seq 474 aa AA seqDB search
MNGYVYLVGAGPGDEGLITKKAIECLNRADIVLYDRLLNPSFLNYTKETCELIYCGKMPK
NHTMRQEMINSHLLQFAKEGKIVVRLKGGDPSIFGRVGEEAETLASANIPYEIVPGITSS
IAASIYAGIPLTHRDYSNSVTLLTGHAKGPLSDHGKYNSSYNSDTIAYYMGIKNLPTICE
NLLQAGKKEDTPVAVIEWGTTGKQRVVTGTLSTIVSIVKNENISNPSMTIVGDVVSLRNQ
ISWKERKPLHSKKVLFASATNKKSAIKQMLQESGAEIYQIPTFKKKEYTLTSEQINKIFN
VDRLVFCSADSVDILMQSCSKYHKDIRSLQAELQYMNLSIQEKLMQYGLFSKPAQFSSNS
TIYLGRNINRIAVIQEKIGAGSYMMTHEYTIDHRFDEIHSRILSEFSWDSIVFEGRASID
TFLAEIKRLGFINILTLPFSYTDVPTLHYANKVGFHNVDHQLQETLMKKDMVRQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatatgtatatttagttggtgcaggaccaggtgatgaagggcttattacaaaa
aaagcgatagagtgcttaaatcgtgcagatatcgtcttatatgaccgcttattaaaccct
tcctttcttaattatacaaaagaaacatgtgaacttatttattgcggaaaaatgccaaag
aatcatactatgcgtcaagaaatgattaactcacacctccttcaatttgcgaaagaagga
aaaatcgtagtccgcttaaaaggcggagatccatctatttttggccgtgttggtgaagaa
gcagaaactttagcatcagcaaatattccatatgaaattgtaccaggtattacatctagc
atcgccgctagtatctatgcaggtattcccctcacccaccgtgactacagtaatagtgtc
actttattaaccggacatgcaaaaggtcctttaagtgatcatggaaaatataattcatct
tacaatagcgacacgattgcctactacatgggtataaaaaacttacctacaatttgtgaa
aacttactacaagcaggaaaaaaagaagatacgccagtagcagtcattgaatggggtaca
actggtaaacagcgcgttgtcacagggacactgtctaccattgtttctattgtcaaaaac
gaaaatatttctaatccttctatgacaattgttggtgatgtcgtttccttacgtaatcaa
atctcttggaaagaacgcaagccattgcacagcaagaaagttttatttgcatctgcaaca
aataaaaaaagcgcaataaagcaaatgttacaagagtccggtgcagaaatatatcaaatt
ccaactttcaaaaagaaagaatacacattaacctctgaacaaatcaataagatttttaac
gttgatcgtcttgtattttgttccgctgacagtgtagacatcttaatgcaatcatgcagt
aaatatcataaagatattcgttccttacaggcagaacttcagtatatgaacctttctatt
caagaaaagctcatgcaatatggattgttcagtaaacctgcgcaattttcttcgaattca
acgatttatttaggacgaaacattaaccgaattgctgttattcaagaaaaaattggtgct
ggttcctatatgatgactcatgagtacacaattgatcatcgcttcgatgaaattcattca
cgtattctttctgaattctcatgggatagcattgtatttgaaggtcgtgcttctattgat
acgtttctagcagaaataaaacgccttggctttatcaatattcttactctcccattctcg
tataccgacgttccaactttacactatgcaaataaagttgggtttcataacgtagatcat
caattacaagaaactcttatgaagaaagacatggtgagacaatga

DBGET integrated database retrieval system