KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch3556Help
Entry
H175_ch3556       CDS       T02474                                 

Definition
Aldehyde dehydrogenase (EC:1.2.1.3)
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H175_ch3556
   00040 Pentose and glucuronate interconversions
    H175_ch3556
   00053 Ascorbate and aldarate metabolism
    H175_ch3556
   00620 Pyruvate metabolism
    H175_ch3556
  Lipid metabolism
   00071 Fatty acid degradation
    H175_ch3556
   00561 Glycerolipid metabolism
    H175_ch3556
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H175_ch3556
   00310 Lysine degradation
    H175_ch3556
   00330 Arginine and proline metabolism
    H175_ch3556
   00340 Histidine metabolism
    H175_ch3556
   00380 Tryptophan metabolism
    H175_ch3556
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H175_ch3556
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    H175_ch3556
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H175_ch3556
Enzymes [BR:btht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     H175_ch3556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3529637..3531121
Genome map
AA seq 494 aa AA seqDB search
MSQLAVNLHEKVEKFLQGTKKLYVNGSFIESASGKTFKTPNPATGETLAVVSEAGREDIH
KAVVAARMAFDEGPWSRMSTAERSRLMYKLADLMEEHKEELAQLETLDNGKPIRETMAAD
IPLAIEHMRYYAGWATKIVGQTIPVSGDYFNYTRHEAVGVVGQIIPWNFPLLMAMWKMGA
ALATGCTIVLKPAEQTPLSALYLAELIEEAGFPKGVINIVPGFGESAGQALVNHPLVDKI
AFTGSTPVGKQIMRQASESLKRVTLELGGKSPNIILPDADLSRAIPGALSGVMFNQGQVC
SAGSRLFVPKKMYDNVMADLVLYSKKLNQGVGLNPETTIGPLVSEEQQKRVMGYIEKGIE
EGAEVLCGGSNPFDQGYFVSPTVFADVNDEMTIAKEEIFGPVISAIPFNDIDEVIERANK
SQFGLAAGVWTESVKTAHYVASKVRAGTVWVNCYNVFDAASPFGGFKQSGLGREMGSYAL
NNYTEVKSVWLNLN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactagctgtaaatcttcatgaaaaggtagaaaagtttcttcaaggtacaaaa
aagttatatgtgaatggatctttcattgaaagcgcttccggcaaaacatttaaaacacct
aacccagcaactggtgaaacacttgccgtcgtttctgaagctggtcgcgaagatattcat
aaagctgtagtcgcagctcgtatggcttttgacgaaggtccttggtctcgtatgagcact
gctgagcgaagccgtctcatgtacaagttagctgatctaatggaagaacataaagaagag
cttgcacagctcgaaacattagataacggaaaaccaatccgtgaaacaatggcagcagac
ataccacttgcaattgagcatatgcgctattacgctggatgggctacgaaaatcgttggt
caaacaattcctgtttccggtgattactttaactatacacgccatgaagctgttggtgtc
gttggtcaaattatcccttggaacttcccgcttcttatggcaatgtggaaaatgggagca
gcgcttgctacaggatgtacaatcgttttaaaacctgcagaacaaactccactatctgct
ctatacttagctgaattaattgaagaagctggattcccgaaaggtgttattaatatcgta
cctggattcggtgaatcagctggacaagctctcgttaatcatccactcgttgataaaatt
gcatttaccggttctactcctgtcggtaaacaaattatgcgacaagcatccgaatcatta
aaacgcgttacacttgaattaggcggtaaatcaccaaatatcatcttgccagatgctgat
ttatctcgcgcgattcctggtgcactttctggtgttatgtttaaccaaggacaagtatgc
tctgctgggtcacgcttatttgttccgaagaaaatgtatgataatgtcatggctgatctc
gtcctctattctaaaaaactaaatcaaggtgtcggtcttaaccctgaaacaacaattggt
cctctcgtttctgaagaacaacaaaaacgtgtaatgggctacatcgaaaaagggattgaa
gaaggcgctgaagtactttgcggaggtagtaatccattcgatcaaggctacttcgtttct
cctacagtattcgctgacgtaaatgatgaaatgacgatcgcaaaagaagaaattttcggt
ccagttatttctgcaataccatttaacgatattgatgaagtaattgaacgtgcaaataaa
tcacaattcggcttagcagctggtgtgtggacagaaagtgttaaaacagcacactatgtt
gcaagtaaagtacgtgctggtacagtatgggtaaactgttataacgtctttgatgcagca
tctccatttggaggatttaaacaatccggtcttggtcgtgaaatgggatcttatgcatta
aataactatacagaagtgaagagcgtttggcttaacttaaattaa

DBGET integrated database retrieval system