KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch4095Help
Entry
H175_ch4095       CDS       T02474                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase @ Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00071  Fatty acid degradation
btht00072  Synthesis and degradation of ketone bodies
btht00280  Valine, leucine and isoleucine degradation
btht00310  Lysine degradation
btht00362  Benzoate degradation
btht00380  Tryptophan metabolism
btht00620  Pyruvate metabolism
btht00630  Glyoxylate and dicarboxylate metabolism
btht00640  Propanoate metabolism
btht00650  Butanoate metabolism
btht00900  Terpenoid backbone biosynthesis
btht01100  Metabolic pathways
btht01110  Biosynthesis of secondary metabolites
btht01120  Microbial metabolism in diverse environments
btht01130  Biosynthesis of antibiotics
btht01200  Carbon metabolism
btht01212  Fatty acid metabolism
btht02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H175_ch4095
   00630 Glyoxylate and dicarboxylate metabolism
    H175_ch4095
   00640 Propanoate metabolism
    H175_ch4095
   00650 Butanoate metabolism
    H175_ch4095
  Lipid metabolism
   00071 Fatty acid degradation
    H175_ch4095
   00072 Synthesis and degradation of ketone bodies
    H175_ch4095
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H175_ch4095
   00310 Lysine degradation
    H175_ch4095
   00380 Tryptophan metabolism
    H175_ch4095
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H175_ch4095
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H175_ch4095
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H175_ch4095
Enzymes [BR:btht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H175_ch4095
Exosome [BR:btht04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H175_ch4095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGG02807
UniProt: M1QDR4
Position
complement(4046650..4047825)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttggaggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacagctgcattagcggcaggatttcctgacacagttacg
ggatatacaatccaacgtcaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaatccaattaggtgtaagtgatgttgttgttgcaggtggagtagaagcgatgagttcg
agcccttatgcattgaaacagcaccgctggggacaacgtctacagcacggagaaattcgt
gacacggtgtgggaagtgttagaagatccgattcaccatattatgatgggtgaaaccgcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgctcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagagcgtagaaaagaagttgtattttcgaaggatgaacatccacgtgca
gatattacagctgaaaaattagctggattgaagccggcattccgtaaagatggatcagtg
actgcgggaaatgcatctggccttaatgacgggagtgcagttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggtttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatgggtattggaccagcaccagcaattcgtaaaggtttagaa
aaagtagattggtcattggaagatgcagatttacttgaaattaatgaagctttcgcggct
caatatttagctgtagagaaagagttaggcttagaccgtgaaaaagtgaacgtaaacggt
agtggcgtaggacttgggcatccaattggttgtacaggggctcgtattacggtaagttta
attcacgaattaaaaagacgtgggttagaaaaaggaattgcctctttatgcgtcggtggc
ggtatcggggttgccttatttatagaagcactataa

DBGET integrated database retrieval system