KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch4457Help
Entry
H175_ch4457       CDS       T02474                                 

Definition
Alcohol dehydrogenase; Acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    H175_ch4457
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H175_ch4457
   00620 Pyruvate metabolism
    H175_ch4457
   00650 Butanoate metabolism
    H175_ch4457
  Lipid metabolism
   00071 Fatty acid degradation
    H175_ch4457
  Amino acid metabolism
   00350 Tyrosine metabolism
    H175_ch4457
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H175_ch4457
   00626 Naphthalene degradation
    H175_ch4457
Enzymes [BR:btht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     H175_ch4457
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     H175_ch4457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4356689..4359292)
Genome map
AA seq 867 aa AA seqDB search
MVVKEKVVNEMQEVKEMIDTLVNNGQQALQALESFTQEQIDNIVHEMALAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKQDKTVGIIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSVAAAKTVYDAAMKAGAPKHCIQWIE
RPSVEATKQLMNHEGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHVKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMIENNCYFVTEEERKKLEKLVINENT
CAVNSDIVGKSAQYIAELVGITVPEHTKMLVAEIQGIGAAYPLSREKLSPVLACVKANSL
EKGFTYCEEMLNLGGLGHSAVIHSTNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVTHYLNKHANDVKIEVFFEVEPDPSDETVFKGAEMMRS
FKPDVIIALGGGSAMDAAKGMWLFYEHPETTFYGIKQKFLDIRKRTCKYSELGNKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVMANDYTDGLALKAIDLVFKYLPRAYKDGNDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVVRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSVAEGVESLVKAIIELGKSLNINMSIAGQGVDKEQFEEVVGVLAERAFE
DQCTTANPKLPLISELKEIYMEAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtcaatgaaatgcaagaggtaaaagagatgattgatacg
ttagtaaataacggtcaacaagctttacaagcattagaaagttttacacaagagcagatt
gacaacattgttcatgaaatggcattagcaggtgttgatcaacatatgccacttgcaaaa
ttggctgttgaagaaacaggccgtggtgtctatgaagacaaatgcattaaaaatattttt
gccactgaatatatttggcatagtataaagcaagataaaacggtaggaattattcacgaa
gatcctcatgaagaaataatagaaattgcagaacctgtcggtgtagtagctggggtaaca
ccagtaacgaatccaacgtcgacaacaatgtttaaagcgttgattgcgataaaaacgaga
aatccaattattttcgcatttcatccttctgcacaaaattgttcggtggcagcagcgaaa
accgtatatgatgcagcaatgaaagctggtgcaccaaaacattgtattcaatggattgaa
agaccgtctgtcgaagcgacgaaacaattaatgaaccatgagggtgtggcactcgttcta
gcaactggaggcgctggtatggtgaaatcagcttactctactggaaaaccagcgctaggt
gtaggtcctggtaatgtaccgtgttatatagaaaaatcagcacatgtaaaacgagctgtt
aatgatttaattttatcgaaaacatttgataacggtatgatttgtgcatcggaacaagca
atcattgtcgataaagaaatctatgatgatgttaaaacagaaatgatcgaaaacaattgt
tactttgtaacagaagaagaaagaaaaaaattagaaaagctcgttataaatgaaaataca
tgtgcagtaaatagtgatattgtaggaaaatcagcacagtatattgccgaattagttggg
attactgttcctgaacatacaaaaatgcttgtagctgaaattcaaggtattggagcagca
tacccgttatctcgtgagaaactgagcccagtattagcctgtgtgaaggcgaattcatta
gaaaaaggatttacatattgcgaagaaatgttgaacctcggtggtttaggacattcagca
gttattcattctacaaataaagaagtgcaaaagcaatttggattacgtatgaaagcttgc
cgtctcattgtaaatgcaccttcatcacaaggtggaataggggatatatataacggattt
attccatcacttacacttggttgtggttcttacggaaaaaattcagtttcccaaaatgta
acagcgactcatttattaaatataaaaaggctggcaaatagaaaaaagaatatgcagtgg
ttcaaattgccgccaaaaatttattttgaaaaacatgctacagcgtatttagcaaatatg
cctaacatttcacgtgcatttattgtaacggatcctggaatggttgaacatggctatgtg
gatacagtcacgcactatttaaacaagcatgcaaatgatgtgaaaattgaagttttcttt
gaggtcgaaccagatccatcagatgaaactgtctttaaaggtgcggaaatgatgagaagc
tttaagccagatgtaattatcgcacttggtggtggttcagctatggatgcagcaaaagga
atgtggttattctatgagcatccagaaacgacattctatggcattaaacagaagttttta
gatataagaaaacgtacatgtaaatattcggaattaggaaataaggcgcagtttgttgcg
attccaacaacatcaggaacaggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccgctcgcagattatgaattaacaccagatgtagcaattgtt
gatccacaatttgtaatgacagtaccaccacatgtaacagcagatactggtatggatgtt
ttaacacatgcaattgaggcgtatgtgtctgttatggcaaatgactatacagatggatta
gcattaaaagctattgatctcgtattcaaatatttaccgagagcatataaagatggaaat
gatgaagaagcacgggaaaaaatgcataacgcttctgcaattgcagggatggcatttgca
aatgcttttctaggtattaatcacagcttagcacataaaattggtccagaattccatatt
ccgcacggacgtgcaaatgcaattcttatgccgcatgtagtccgctataatgctattaag
ccaagaaaacacgcattgttcccaaaatatgagcactttgtagcagatgaacgctatgca
catattgcgagaatgctcgggcttccagcaagctcagtagcagaaggtgtggaatcactc
gtcaaagcaattattgagcttggaaaaagcttaaatattaatatgagtattgcaggacaa
ggggtagataaagagcaatttgaagaggttgttggagtattagcagaaagagcttttgaa
gatcaatgtacaactgctaatccaaagttaccgcttatttcagagctgaaagaaatttat
atggaagcatataaaggtgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system