KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch4546Help
Entry
H175_ch4546       CDS       T02474                                 

Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H175_ch4546
Enzymes [BR:btht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     H175_ch4546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4450315..4451067)
Genome map
AA seq 250 aa AA seqDB search
MNALAGKTVLITRAQHQAKQMSVAVKEKSGIPLEIPLLRMEGMSHRQIQHIEEQLHSYDW
VIFTSRNGVAFFLDSLKKKLPLTIKIAAVGVKTKLELEKRGYQVHFVPTSFVAEAFAEEL
LKELNGNERILFPKGNLARDVIPVKLREIGVFLDELIVYGTKVNVEKKQELIAALKLGEV
DIITFTSPSTVTSFVRLLEGANWREWTKKCTIACIGPITEKEASRYFPSVIVPKEYTVEA
LLQCVCESIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctggaaaaacggtattgattacacgtgcccagcatcaagcgaaacaa
atgagtgtagcagtgaaagaaaagagcggaattccattggaaattccgcttttgcgtatg
gaaggtatgtctcataggcaaattcaacatattgaagagcagctacattcatacgactgg
gttatttttacgagcagaaatggtgtagctttttttctagatagtttaaaaaagaaacta
ccactaaccattaaaatcgctgcggtaggtgtgaaaacaaaattagagttagaaaaaagg
ggctatcaagttcattttgttccgacttcatttgttgcagaagcatttgccgaagagctt
ctaaaagaattaaatggaaacgaacgtattttatttccaaaaggcaatttagcaagagat
gtaataccagttaaactgcgtgaaattggtgtttttctagatgagttgatcgtatacggt
acgaaagtgaatgtagaaaaaaagcaagagcttatagcagcgttgaagttaggagaagta
gacattattacatttacgagtccttcaactgttactagttttgttcgtttacttgagggt
gcaaactggagagaatggacaaaaaaatgtacaattgcttgtataggacctattacggaa
aaagaggcaagtcgttattttccgtctgttattgtgccgaaagagtacactgtagaagca
ttactacaatgtgtttgtgaatctataaaatga

DBGET integrated database retrieval system