KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch4546Help
Entry
H175_ch4546       CDS       T02474                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00860  Porphyrin and chlorophyll metabolism
btht01100  Metabolic pathways
btht01110  Biosynthesis of secondary metabolites
btht01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H175_ch4546
Enzymes [BR:btht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     H175_ch4546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGG03257
UniProt: M1QEX7
Position
complement(4450315..4451067)
Genome map
AA seq 250 aa AA seqDB search
MNALAGKTVLITRAQHQAKQMSVAVKEKSGIPLEIPLLRMEGMSHRQIQHIEEQLHSYDW
VIFTSRNGVAFFLDSLKKKLPLTIKIAAVGVKTKLELEKRGYQVHFVPTSFVAEAFAEEL
LKELNGNERILFPKGNLARDVIPVKLREIGVFLDELIVYGTKVNVEKKQELIAALKLGEV
DIITFTSPSTVTSFVRLLEGANWREWTKKCTIACIGPITEKEASRYFPSVIVPKEYTVEA
LLQCVCESIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctggaaaaacggtattgattacacgtgcccagcatcaagcgaaacaa
atgagtgtagcagtgaaagaaaagagcggaattccattggaaattccgcttttgcgtatg
gaaggtatgtctcataggcaaattcaacatattgaagagcagctacattcatacgactgg
gttatttttacgagcagaaatggtgtagctttttttctagatagtttaaaaaagaaacta
ccactaaccattaaaatcgctgcggtaggtgtgaaaacaaaattagagttagaaaaaagg
ggctatcaagttcattttgttccgacttcatttgttgcagaagcatttgccgaagagctt
ctaaaagaattaaatggaaacgaacgtattttatttccaaaaggcaatttagcaagagat
gtaataccagttaaactgcgtgaaattggtgtttttctagatgagttgatcgtatacggt
acgaaagtgaatgtagaaaaaaagcaagagcttatagcagcgttgaagttaggagaagta
gacattattacatttacgagtccttcaactgttactagttttgttcgtttacttgagggt
gcaaactggagagaatggacaaaaaaatgtacaattgcttgtataggacctattacggaa
aaagaggcaagtcgttattttccgtctgttattgtgccgaaagagtacactgtagaagca
ttactacaatgtgtttgtgaatctataaaatga

DBGET integrated database retrieval system