KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch5459Help
Entry
H175_ch5459       CDS       T02474                                 

Definition
Thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:btht00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5314976..5315563)
Genome map
AA seq 195 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEDMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTNKDK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcaaaatggctggattgaagtgatttgcggtagtatgttttctggt
aaatcagaagagttaatccgccgtgtgcgccgtacgcaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgctatagtgaagaagacgttgtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaagatatatttgaacatatcactgaa
gatatggatgtaattgcaatcgatgaggtacaattctttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaacaaag
ctacaagcagtatgttctgcatgtggatctccggcaagtcgtacacaacgattaattgat
ggagaaccagcggcatttgatgatccgattattttagttggggcttcagaatcgtatgag
ccacgctgtcgtcattgtcatgcagttcctacaaacaaagataagtaa

DBGET integrated database retrieval system