KEGG   Bacillus thuringiensis YBT-1518: YBT1518_10725Help
Entry
YBT1518_10725     CDS       T02930                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bthu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YBT1518_10725
   00330 Arginine and proline metabolism
    YBT1518_10725
   00340 Histidine metabolism
    YBT1518_10725
   00350 Tyrosine metabolism
    YBT1518_10725
   00360 Phenylalanine metabolism
    YBT1518_10725
   00380 Tryptophan metabolism
    YBT1518_10725
Enzymes [BR:bthu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     YBT1518_10725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2117768..2119204
Genome map
AA seq 478 aa AA seqDB search
MGNPLAMEEMLHIIHAGLVKKNNPKRITIAGAGISGLVAGSLLKEAGHEVTIIEANNRIG
GRVYTIREPFSVGLYFNAGPMRIPDTHKLTLAYIHKFKLPLNLFINKTFADIIYTNNIQT
RLNVFENDPSVLEYPVLDKERGKTAEELMIEVLEPILNYIKKDPDKNWLIVEKKYKTYSL
GSFLMEYYSDGAIDMIGVLLDMEAYMGMSLIEVLREMIFFTSTTKYYEITGGMDKLSNAF
LPQLREHILMPYKVDKIIQEDNKVMLQGNHEQTLEQFTITSDFAIITIPFSALRFVEVQP
YYLFSYFKKRAIRELNYIAATKIAIEFKSRFWEKAGQCGGKSITDLPIRFTYYPSYGIHT
PGPAIVIASYTWADEALTWDSLPQRDRIRYALKNLAEIYGDIVYSEFVTGTSFSWSKNPY
SCGAFTAFEPGQELELFPYITPPSGKVHFAGEHTTLTHGWMQGAIESGVRVAYEVNEQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggggaacccattagcaatggaagaaatgcttcatattattcatgcagggcttgttaaa
aagaataacccaaaacggattacgattgcaggtgcagggatttctggattagttgcaggt
tctttattaaaagaggctgggcacgaagtaacgattatagaagcaaataacagaataggt
ggcagggtgtatacgattcgggaaccatttagtgtgggtttatattttaatgcgggaccg
atgagaatccctgacacccataagttaaccttagcgtatattcataaatttaaactacct
ttaaacctttttataaataaaacttttgcagatatcatttatacgaataacattcaaacg
agattgaatgtgtttgaaaatgatccaagtgtacttgaatatccggttttggataaagaa
agaggaaaaacggcagaagagctaatgattgaagtattagaaccaatactaaattacatt
aagaaggatcctgataaaaactggcttatcgttgaaaaaaagtataaaacgtattcgctt
ggttcatttttaatggagtattattcagatggtgcgatagatatgattggggtacttctt
gatatggaagcttatatgggaatgtccttaattgaagtattacgtgaaatgattttcttt
acttcaacaacgaaatattatgaaataactggtggaatggataagttatcgaatgcattc
ttaccacaattaagggaacatattttaatgccgtataaggttgataaaattatacaagaa
gataataaagtaatgttacaaggaaatcatgaacaaacgttagagcaatttacaataaca
agtgattttgctattattacaattccattttcagcgttaagatttgtagaagttcagcca
tactatttattctcttattttaaaaaaagagcaattcgtgaattaaattatattgctgca
actaaaattgcaatagagtttaaaagtagattttgggagaaagcgggacagtgtggcggt
aaatctattactgatttaccgatacggtttacatactatccgagttatggcattcatact
ccaggaccagctatcgtaatagcaagttatacgtgggcagatgaggcgttaacatgggat
agtctcccgcaaagagatcgtattcgttacgcattaaaaaatttagcggaaatatacggt
gacatcgtctatagtgagtttgtcactggaacatcttttagctggagtaaaaatccgtat
tcttgcggtgcatttacagctttcgaaccaggccaagagctcgagttatttccgtatatt
acaccaccatctggaaaagtacattttgcaggagagcatacgacattaacacatggatgg
atgcaaggggcaattgagtctggagtaagagttgcatatgaagtaaatgaacagtga

DBGET integrated database retrieval system