KEGG   Bacillus thuringiensis YBT-1518: YBT1518_11220Help
Entry
YBT1518_11220     CDS       T02930                                 

Definition
(GenBank) amine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00260  Glycine, serine and threonine metabolism
bthu00330  Arginine and proline metabolism
bthu00340  Histidine metabolism
bthu00350  Tyrosine metabolism
bthu00360  Phenylalanine metabolism
bthu00380  Tryptophan metabolism
bthu01100  Metabolic pathways
bthu01110  Biosynthesis of secondary metabolites
Module
bthu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bthu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YBT1518_11220
   00330 Arginine and proline metabolism
    YBT1518_11220
   00340 Histidine metabolism
    YBT1518_11220
   00350 Tyrosine metabolism
    YBT1518_11220
   00360 Phenylalanine metabolism
    YBT1518_11220
   00380 Tryptophan metabolism
    YBT1518_11220
Enzymes [BR:bthu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     YBT1518_11220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 HI0933_like Pyr_redox FAD_binding_3 AlaDh_PNT_C FAD_binding_2 Thi4 MCRA GIDA DAO FAD_oxidored Prenylcys_lyase 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AHA71429
UniProt: V5M9N9
Position
2212083..2213546
Genome map
AA seq 487 aa AA seqDB search
MQKDIMYNTEMDEALKVIDKGLKKTINPKQIIVVGAGMAGLVSASLLKAAGHDVKIFEAN
NRVGGRIETVRMEDTGLYLDVGAMRIPYSHTLTMAYIRKFGLQVGPFINRNETDIIYVNG
RKTTLKQYEKDPNILRYPVEMNEVGKTSEELLLLAVQPIINFIKRNPEKNWDVVVKDFGR
YSTGQFLKYHPYQYNTYFSPVTIEMIGVLLDLEGFLERSFVETLRFLYIMQEESGFCEIV
GGNDRLPKSFLPQLEENIIYNQKLMKLHQHDNGVTAFYRNEETFEYSSITGDLVIVTIPF
STMRFVEVDPFDSISHEKWKAIRELHYMPATKIGIQFKSRFWEEQGQLGGRIITDLPIRY
AYYPSYGIGEKGPAMMLGSYTWSYDALLWDGLSKGDRIYYALHNLATILGGQVYDEFISG
ISKSWTLDPYALGGFALFQAGQESELQPAIVKPEGRIFFAGDHTTLYHGWIQGAIESGIR
VAAEVNE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaagatataatgtataacactgaaatggatgaagcgttaaaagttatagataaa
ggattgaagaagacgataaatccaaaacaaattattgtagtgggagctggtatggctgga
ttagtttcagcatctttattaaaggctgcaggacatgatgtgaaaatttttgaagcaaac
aaccgggtaggtggccgtatagaaacggttagaatggaagataccggattatatttagat
gtcggagcaatgagaattccgtattcgcatacattaacgatggcgtatataagaaaattt
gggctacaggtgggtccttttattaatagaaatgagacggatattatatacgtaaatgga
cggaaaacgacgttgaaacaatatgaaaaggatccaaatattttaaggtatcctgtggaa
atgaatgaagtgggaaaaacgtctgaagaactattgttattagcagtacagccgataata
aattttattaaaagaaatccagagaaaaattgggatgttgtagtgaaggattttgggaga
tattccacaggacaatttttgaagtatcacccttatcagtataatacttacttttcgcca
gtaacaattgagatgattggtgttctattagatttagaaggttttttggaacgatcgttt
gtagagactttacgctttctatacattatgcaagaggagagcggattttgtgaaattgtg
ggcgggaacgatagattgccaaagtcatttttaccgcaattagaagagaatattatatat
aatcaaaaattaatgaagctacatcaacacgataatggtgtgacagctttctatcggaac
gaggaaacttttgaatatagcagtattacaggagatttagttattgttaccattccgttt
tcgacaatgcgttttgtagaagtagatccgtttgattctatatctcatgaaaaatggaaa
gcaattcgtgaattacattatatgcctgcgacgaaaataggaattcaatttaaaagccga
ttttgggaagaacaaggacaattaggtggcagaattataacagatttgccaattcgttat
gcctattatccaagttatggaattggtgagaaaggaccggctatgatgttaggtagctat
acatggtcttatgacgcattgttatgggatggtttatcaaaaggtgatcgtatttattac
gcattacacaacttagcaacaatattaggtggtcaagtgtatgatgagttcatatctgga
atatcaaaaagctggacattggatccgtatgcgcttggaggatttgcactttttcaagca
ggtcaagaatctgagcttcaaccagcgattgtcaaaccagaggggagaatattcttcgct
ggagatcatacaacgctatatcacggatggattcaaggtgcgattgaatctggaattcgt
gtagcggcggaagtgaatgagtaa

DBGET integrated database retrieval system