KEGG   Bacillus thuringiensis YBT-1518: YBT1518_11220Help
Entry
YBT1518_11220     CDS       T02930                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bthu00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bthu00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bthu00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bthu00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bthu00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bthu00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2212083..2213546
Genome map
AA seq 487 aa AA seqDB search
MQKDIMYNTEMDEALKVIDKGLKKTINPKQIIVVGAGMAGLVSASLLKAAGHDVKIFEAN
NRVGGRIETVRMEDTGLYLDVGAMRIPYSHTLTMAYIRKFGLQVGPFINRNETDIIYVNG
RKTTLKQYEKDPNILRYPVEMNEVGKTSEELLLLAVQPIINFIKRNPEKNWDVVVKDFGR
YSTGQFLKYHPYQYNTYFSPVTIEMIGVLLDLEGFLERSFVETLRFLYIMQEESGFCEIV
GGNDRLPKSFLPQLEENIIYNQKLMKLHQHDNGVTAFYRNEETFEYSSITGDLVIVTIPF
STMRFVEVDPFDSISHEKWKAIRELHYMPATKIGIQFKSRFWEEQGQLGGRIITDLPIRY
AYYPSYGIGEKGPAMMLGSYTWSYDALLWDGLSKGDRIYYALHNLATILGGQVYDEFISG
ISKSWTLDPYALGGFALFQAGQESELQPAIVKPEGRIFFAGDHTTLYHGWIQGAIESGIR
VAAEVNE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaagatataatgtataacactgaaatggatgaagcgttaaaagttatagataaa
ggattgaagaagacgataaatccaaaacaaattattgtagtgggagctggtatggctgga
ttagtttcagcatctttattaaaggctgcaggacatgatgtgaaaatttttgaagcaaac
aaccgggtaggtggccgtatagaaacggttagaatggaagataccggattatatttagat
gtcggagcaatgagaattccgtattcgcatacattaacgatggcgtatataagaaaattt
gggctacaggtgggtccttttattaatagaaatgagacggatattatatacgtaaatgga
cggaaaacgacgttgaaacaatatgaaaaggatccaaatattttaaggtatcctgtggaa
atgaatgaagtgggaaaaacgtctgaagaactattgttattagcagtacagccgataata
aattttattaaaagaaatccagagaaaaattgggatgttgtagtgaaggattttgggaga
tattccacaggacaatttttgaagtatcacccttatcagtataatacttacttttcgcca
gtaacaattgagatgattggtgttctattagatttagaaggttttttggaacgatcgttt
gtagagactttacgctttctatacattatgcaagaggagagcggattttgtgaaattgtg
ggcgggaacgatagattgccaaagtcatttttaccgcaattagaagagaatattatatat
aatcaaaaattaatgaagctacatcaacacgataatggtgtgacagctttctatcggaac
gaggaaacttttgaatatagcagtattacaggagatttagttattgttaccattccgttt
tcgacaatgcgttttgtagaagtagatccgtttgattctatatctcatgaaaaatggaaa
gcaattcgtgaattacattatatgcctgcgacgaaaataggaattcaatttaaaagccga
ttttgggaagaacaaggacaattaggtggcagaattataacagatttgccaattcgttat
gcctattatccaagttatggaattggtgagaaaggaccggctatgatgttaggtagctat
acatggtcttatgacgcattgttatgggatggtttatcaaaaggtgatcgtatttattac
gcattacacaacttagcaacaatattaggtggtcaagtgtatgatgagttcatatctgga
atatcaaaaagctggacattggatccgtatgcgcttggaggatttgcactttttcaagca
ggtcaagaatctgagcttcaaccagcgattgtcaaaccagaggggagaatattcttcgct
ggagatcatacaacgctatatcacggatggattcaaggtgcgattgaatctggaattcgt
gtagcggcggaagtgaatgagtaa

DBGET integrated database retrieval system