KEGG   Bacillus thuringiensis YBT-1518: YBT1518_13020Help
Entry
YBT1518_13020     CDS       T02930                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bthu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YBT1518_13020
Enzymes [BR:bthu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     YBT1518_13020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2564843..2566234
Genome map
AA seq 463 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILIEKEEYLGGKIHSVEEKGFIMESGA
DSIVARNEHVMPLVKDLNLENEMVYNETGISYIYSENMLHPIPSDTIFGIPMSARSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLALFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIINRLEEVLTETV
VKKGAITTAVSKQEDRYEISFANHETIQADYVVLAAPHDIAQTLLQSNELNEQFNTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKDYNEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQAVQAL
QEKMTNLYPNVYLAGASYYGVGIGACIGNGKNIANEIMATLNK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgttgttatcggtggaggtataacgggactttctactatgttttattta
gaaaaattaaaaaaggattataatatcgatttaaatttaattcttattgagaaagaagag
tatttaggtggtaaaatccatagtgtggaagaaaagggtttcattatggagtcaggggcg
gattcaatcgttgctcgtaatgaacatgttatgccacttgtaaaagatttaaatttagaa
aatgaaatggtatataatgaaacgggtatttcttacatatattctgaaaacatgttacat
ccaattccttctgatactatatttgggataccgatgagtgcccggtcgttgtttagcagt
acgctagtctcaacgaaggggaaaatcgtagctttaaaagatttcataacgaaaaataaa
gagtttacgaaagatacatcacttgctctatttttagaaagctttttagggaaagagtta
gtggaaagacaaattgctcctgtgctttcaggcgtatattctggtaaattgaatgagctt
acaatggcatctacattaccgtatttactggattataaaaataagtatggaagtattatt
aaaggttttgaagagaataaaaaacaatttcaatcagcaggaaataaaaaattcgtatca
tttaagggtggattatctacgataattaatcgcttagaagaagtgctgactgaaactgtc
gtaaaaaaaggtgctataacgacggctgtaagtaaacaagaagatcgatatgagatttct
tttgcaaatcatgaaacaatacaagcagattatgttgttttagcagctccacatgatata
gcgcaaactttattacagtctaatgagttaaatgagcagtttaatacatttaaaaactca
tctcttattagtatttatttaggatttgacatactagatgaacaactaccagctgacggt
acggggtttattgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagt
cgaaagtggaaacatacatcgggtaaacaaaaattattagttagaatgttttataagagt
accaatccggtatatgaaacaatcaaggattacaatgaagaagaattagtacgagtagct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagttaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcggttcaagcattg
caagaaaaaatgacaaatctttatccaaatgtatatttagctggtgcctcatattacggt
gttggaattggtgcgtgtattggaaatggaaagaatattgccaatgaaataatggctaca
ttaaataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system