KEGG   Bacillus thuringiensis YBT-1518: YBT1518_16495Help
Entry
YBT1518_16495     CDS       T02930                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bthu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YBT1518_16495
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    YBT1518_16495
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YBT1518_16495
Enzymes [BR:bthu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     YBT1518_16495
Exosome [BR:bthu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YBT1518_16495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3243132..3244805)
Genome map
AA seq 557 aa AA seqDB search
MVNYGVKMKKLLLVGAIIVSVLSAESMMNYHAAKAKLKKVEHQPKNIIMMVMDGTSSTAT
TLARWYKGAPLTLDQIVTGGVRTFSAESAITDSAPAATALATGNKSNSGYVGVLPSIVNS
PNLKPIKEEDKLRPVANVLEGAKRTGRATGIVATSEIQHATPAGFSAHHVNRKQFDVIAK
QQVYQNIDVVLGGGKAALLPMKSNGIQKDGENLVKVIQDKGYDFVETKDALLNSKSNKIW
GSFSNHALAFDIDRIATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHANDP
IGMISDVLAFDEAVAKALQFAKKDGDTMIIALTDHGNSGISIGNRNTTKGYNTTPISAYI
DPLKKAKMTLEGTINKLKSDLSNVEDVAKLYGLDNLTHDEKEKLKAAKKKIDVGRILTTL
LANRANIGFTTGGHTGEDVFLHSYGPQKPEGLIQNTDIAKTMAKAMGFNLEEVTNKIFLE
SEQAFKKVGATVTADKTEGANSLLVVKHNKVEAQLFGNKNIIRINGKGYELGSIIVESNG
KCYVPEEAIQLFVKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggttaattatggtgtgaagatgaaaaaattactattagtgggggctataatagtaagc
gtattaagtgcggaaagtatgatgaattatcatgcggccaaagctaagctgaaaaaagta
gaacaccagcctaaaaatataattatgatggttatggacggaacgagttcaacggcgaca
acattggcccgctggtataaaggggcaccgcttacgttagatcaaattgtaacaggaggt
gttcgtacgttttcggcggaatcagctattacagactcagcgccagcagcaacagcatta
gcaactggaaataaatcgaattcaggatatgtaggcgtactaccttctattgtaaattca
cctaacttaaagccaataaaagaagaggacaagttacggccggtcgcaaacgtattggaa
ggtgcaaaacgtactggccgtgcaactggaattgttgctacatctgaaattcagcatgct
actccggcgggattctcggctcaccatgtcaatcgcaagcaatttgacgtaattgcgaag
cagcaagtatatcaaaatatagatgtcgtattaggcgggggaaaagcggcgctgctacct
atgaaaagtaatggaatccaaaaagatggtgaaaatttagtaaaggtgattcaagacaaa
ggatacgattttgttgaaacgaaagatgcgttattgaactccaaatctaataaaatttgg
ggctctttctcaaatcatgctcttgcgtttgatatagatcgtatagcaacaaatccagaa
caaccaacactttctcaaatgacagaaaaagcaattcaaacattatcaaaagacaaagat
ggtttctttttattcgtagaaggtagtaagcctgattgggcagctcatgctaatgatcca
attgggatgattagtgatgtattggcatttgatgaagcggtagcaaaggcgttacaattt
gcgaagaaagatggggatacgatgatcatcgctttaactgatcatggtaacagcggcatc
tctatagggaataggaatacgacaaaaggatacaatactacaccgatttctgcatacatt
gatccattgaaaaaggcgaaaatgacacttgaaggaactataaataaattgaaatctgat
ttatcaaatgtagaagatgtagctaaactatacggtttggataatctaactcatgatgaa
aaagaaaaattaaaagcggcaaaaaagaaaatagatgtaggacgaattcttactacatta
ttggctaatcgtgcaaatatcggctttacgacaggaggacatacaggtgaggatgtattt
ttacattcttatggacctcaaaaaccagaaggcttaatccaaaatacagacattgcgaag
acgatggcgaaagcgatgggctttaacttagaagaagtaacgaataaaatatttttagag
agtgaacaagcctttaagaaagtcggtgcaactgtaacagctgacaaaaccgaaggagca
aactcgttactcgtggtaaaacataataaagtagaagcacaactatttggtaacaaaaat
ataattcgtatcaatggtaaagggtatgaattaggaagtattattgtagagagtaacgga
aagtgttatgtaccagaagaagcaattcaactatttgtaaagcattctcgttaa

DBGET integrated database retrieval system