KEGG   Bacillus thuringiensis YBT-1518: YBT1518_18920Help
Entry
YBT1518_18920     CDS       T02930                                 

Definition
cytoplasmic alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bthu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3722536..3724077)
Genome map
AA seq 513 aa AA seqDB search
MFKRITIVGLSVVLFLTGIYGESKAYADTVNNGTLMQYFEWYAPNDGNHWNRLRTDAENL
AQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHK
KNIDVYGDVVMNHKGGADYTETVTAVEVDPSNRNVEVSGDYEISAWTGFNFPGRGDSYSN
FKWKWYHFDGTDWDEGKKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKKWGTWYAKELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTL
NNYLAKVNYNQSVFDAPLHYNFHYASTGNGNYDMRNILKGTVVANHPTLAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTKGNSNYEIPALKDKIDPILTA
RKNFAYGTQRDYFDHPDVIGWTREGDSIHANSGLATLISDGPGGTKWMDVGKNNAGEVWY
DITGNQTNTVTINKDGWGQFQVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagaataacaatagtcggattgtcagttgttttgtttttaactggtatatat
ggggagagtaaggcatatgcagatacagttaacaatggaacgttaatgcagtattttgag
tggtacgctccgaatgatgggaatcattggaatcgtttgcgtactgatgctgaaaattta
gcgcaaaaaggaattacatctgtttggataccacctgcatataaaggaactacgcaaaat
gacgtaggatatggagcgtatgatttatatgatttgggggaattcaatcaaaagggaaca
gtgcggacgaaatatgggacgaaagcacaattgaaatctgcaattgacgctttacataag
aaaaacatcgatgtatacggtgatgtagttatgaatcataaaggtggggctgattatacg
gaaacagtcacagcagttgaagtagacccgagcaatcgaaatgttgaagtatcaggtgat
tatgaaattagtgcgtggacaggctttaactttccagggcgtggagattcttattctaat
ttcaaatggaaatggtatcattttgacggaacagattgggatgaaggaaagaaattaaac
cgaatttataaatttaggggcataggtaaagcatgggactgggaagtgtctagcgagaat
gggaattatgattatttgatgtacgcggatcttgattttgatcatccagatgttgcgaat
gaaatgaaaaaatggggaacgtggtatgcgaaggaattaaatttagatggctttcgttta
gatgctgttaaacatattgatcatgaatatttgcgcgattgggtaaatcatgttagacag
caaacggggaaagaaatgtttacagtagctgaatattggcaaaatgatatccagacttta
aataattatttagcgaaggtcaattataatcaatctgtgttcgatgcaccgctgcattat
aattttcattatgcttcaacaggaaatgggaattatgatatgagaaatattttaaaagga
acggtagttgcgaatcatcctacacttgcggttactctagttgaaaatcatgattcacag
cctggtcagtcattggaatctgtagtgagcccttggttcaaaccgttggcatatgcattt
attttaacgcgtgcagagggatatccttctgttttctatggtgattactatggtacaaaa
ggaaatagtaactatgaaattccagcgttaaaggacaaaattgatccgattttgacggca
cgaaaaaactttgcatatggtacgcagcgggattattttgatcatccagatgtaattggc
tggacaagagaaggtgatagtatacatgctaattctggtttagcaacattaatctctgat
ggaccaggagggacaaagtggatggatgtcggaaagaataacgcaggggaagtatggtac
gatattacgggtaatcaaacaaatactgtaacaattaataaggacggttgggggcagttc
caagtaagtggaggatcagtttccatatatgttcagcagtaa

DBGET integrated database retrieval system