KEGG   Bacillus thuringiensis YBT-1518: YBT1518_25350Help
Entry
YBT1518_25350     CDS       T02930                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bthu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    YBT1518_25350
Enzymes [BR:bthu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     YBT1518_25350
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     YBT1518_25350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4957779..4958609)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVENVRRTLENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGEKIENIKRRGK
FLLLYVTNYVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLF
KKGEEMNQMPLADLGPEPFDTELTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEV
LFRSQIHPEREASSLTIEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLN
VYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPRI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaacgtcagacggacacttgaaaatcttgtaacagga
aaaacgattgaagatgttattgttacttatccaaaaatagtgaaacgaccggatgatgca
gaaatctttaaagaaatgctaaaaggcgagaagattgaaaatataaagcgaagaggaaag
tttttgcttctatatgtaacaaattatgttattgtttcacatttgcgtatggaaggtaag
tttttactacatcaagaggatgagccgattgataaacatacgcacgtccgtttcttattt
acagatggaactgaattacattataaagatgtgagaaagtttggtacgatgcatctcttt
aagaaaggtgaagagatgaaccaaatgcctcttgctgacttaggtccggagccgtttgat
actgaattgacaccacagtatttacaagaaagattgcaaaagacaaatcgtaaaataaaa
gttgtgctattggaccagcgtcttttagtagggcttggaaatatatatgtagatgaagtt
ttattccgttctcaaattcatccggaacgagaagcttcgtctttgacaatagaagaaatt
gagcgaatttatgaggctaccgttacaacgctaggcgaagcagtgaagcgtggtggaagt
acaattcgaacgtatatcaactcacaagggcaaattggttcgttccaagaactcctaaat
gtatacggaaaaaaaggagaaccgtgtgtaacttgcggtacgatattagaaaaaacagtt
gttggcgggcgaggaacgcattactgcccaatttgtcagccaagaatatag

DBGET integrated database retrieval system