KEGG   Bacillus thuringiensis HD-771: BTG_04400Help
Entry
BTG_04400         CDS       T02293                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTG_04400
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTG_04400
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTG_04400
Enzymes [BR:bti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BTG_04400
Exosome [BR:bti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTG_04400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892336..894009
Genome map
AA seq 557 aa AA seqDB search
MLNYGVKIKKLLLVAAIIVSVLSTESMMNYHAAKAKVKKVEHQPKNIIMMVMDGTSSTAT
TLARWYKGAPLTLDQIVAGGVRTFSAESAITDSAPAATALATGNKSNSGYVGVLPSIVNS
PSLKPIKEEDKLRPVANVLEGAKRTGRATGIVATSEIQHATPAGFSAHHVNRKQFNVIAK
QQVYQNIDVVLGGGKAALLPIKSNGIRKDGENLVKVIQDKGYDFVETKDALLNSKSNKIW
GSFSHHALAFDMDRIATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHANDP
IGIISDVLAFDEAVAKALQFAKKDGDTMLIALTDHGNSGISIGNRNTTKGYNTTPVSAYI
DPLKKAKMTLEGTINKLKSDLSNVEDVAKLYGLDNLTHDEKEKLKAEKKKMDVGRILTTL
LANRANIGFTTGGHTGEDVFLYSYGPQKPEGLIQNTDIAKTMAKAMGFNLEEVTNKIFLE
SEQAFKKIGATVTADKTEGVNPLLVVKHNKVEAQLFGNKNIIRINGKGYELGSIIVESNG
KCYVPQEAIQLFVKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgttgaattatggtgtgaagataaaaaagttgctattagtggcagctataatagtaagc
gtattaagtacggaaagtatgatgaattatcatgcggccaaagctaaggtgaaaaaagta
gaacatcagcctaaaaatataattatgatggttatggacgggactagttcaacggcgaca
acattggctcgctggtataaaggggcaccgcttacgttagatcaaattgtagcaggaggt
gttcgtacgttttcggcggaatcagctattacagactcagcgccagcagcaacagcatta
gcaactggaaataaatcgaattcaggatatgtaggtgtactaccttctattgtaaattca
cctagcttaaagccaataaaagaagaggacaagttacggccggtcgcaaacgtattagaa
ggtgcaaaacgtactggtcgtgcaacgggaattgttgctacatctgaaattcagcatgct
actccggcgggattctcagctcaccatgtcaatcgcaagcaatttaacgtaattgcgaag
cagcaagtatatcaaaatatagatgtcgtattaggcgggggaaaagcggcgcttctacct
ataaaaagtaatggaatccgaaaagatggtgaaaatttagtaaaggtgattcaagacaaa
ggatacgattttgttgaaacgaaagatgcgttattgaactccaaatctaataaaatttgg
ggctctttctcacatcatgctcttgcgtttgatatggatcgtatagcaacaaatccagaa
caaccgacactttctcaaatgacagaaaaagcaattcaaacattatcaaaagataaagat
ggcttttttttattcgtagaaggtagtaagccagattgggcagctcatgctaatgatccg
attgggattattagcgatgtattggcatttgatgaagcggtagcaaaggcgttacaattt
gcgaagaaagatggggatacgatgcttatcgctttaactgatcatggtaacagcggcatc
tctatagggaataggaatacgacaaaaggatacaatactacaccggtttctgcatacatt
gatccattgaaaaaggcgaaaatgacacttgaaggaactataaataaactgaaatctgat
ttatcaaatgtagaagatgtagctaaactatacggtttggataatctaactcatgatgaa
aaagaaaaattaaaagcggaaaaaaagaaaatggatgtaggacgaatccttactacatta
ttggctaatcgtgcaaatatcggctttacgacaggaggacatacaggtgaggatgtattc
ttatattcttatggacctcaaaaaccagaaggcttaatccagaatacagacattgcgaag
acgatggccaaagcgatgggctttaacttagaagaagtaacgaataaaatatttttagag
agtgagcaagcctttaagaaaatcggtgcaactgtaacagccgacaaaaccgaaggagta
aacccgttacttgtggtaaaacataataaagtagaagcacaactatttggtaacaaaaat
ataattcgtatcaatggtaaagggtatgaattaggaagtattattgtagagagtaatgga
aagtgctatgtaccacaagaagcaattcaactatttgtaaagcattctcgttaa

DBGET integrated database retrieval system