KEGG   Bacillus thuringiensis HD-771: BTG_09215Help
Entry
BTG_09215         CDS       T02293                                 

Definition
(GenBank) bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00860  Porphyrin and chlorophyll metabolism
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
bti01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTG_09215
Enzymes [BR:bti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BTG_09215
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BTG_09215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: AFQ15309
UniProt: J3ZRL3
Position
1800371..1801795
Genome map
AA seq 474 aa AA seqDB search
MNGYVYLVGAGPGDEGLITKKAIDCLKRADIVLYDRLLNPFFLSYTKETCELMYCGKMPK
NHIMRQEMINAHLLQFAQEGKIVVRLKGGDPSIFGRVGEEAETLAAANVPYEIVPGITSS
IAASSYAGIPLTHRNYSNSITLLTGHAKGPLTDHGKYNSSYNSDTIAYYMGIKNLPTICE
NLLQVGKKKDTPVAVIEWGTTGKQRVVTGTLSTIVSIVKDENISNPSMTIVGDVVSLRNQ
ISWKERKPLHGKKVLLASATNKKSAIKQMLQESGAEIYQIPIFQKKEYTLTSEQINKIFN
VDRLVFCSAESVDILVQSCSKYHKDIRSLQAELQYMNLSIQEKLMQYGLLSKPAQFSSNS
TIYLGRNINRIAVIQEKIGAGSYMMTHEYTIDHRFDEIHSRMLSEFSWDSIVFEGRASID
TFLAEIKRLGFINILTLPFSYTDVPTLHYANKVGFHNVDEQLQDMIMKKDLVVR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatatgtatatttagttggtgcaggaccaggtgatgaagggcttattacaaag
aaagcgatagattgtttaaagcgtgcagatatcgttttatatgaccgtttattaaaccct
ttctttcttagttatacaaaagaaacatgtgaacttatgtattgcggcaaaatgccaaag
aatcatattatgcgacaagaaatgattaacgcccacctccttcaattcgcacaagaagga
aaaatcgttgtccgattaaagggcggagatccatctatttttgggcgcgttggtgaagaa
gcagaaactttagcagcagcgaacgttccatatgaaatcgtaccaggtattacatctagc
atcgccgctagtagctatgcaggtatccccctcacccaccgtaactacagtaatagcatc
actttattaactgggcatgcaaaaggccctttaaccgatcatggaaaatataattcatcc
tataatagcgacacgatcgcctactacatgggtataaaaaacttacctacaatttgtgaa
aacttactacaagtaggaaagaaaaaagatacaccagtagccgtcattgaatggggtaca
actggtaaacaacgtgtagtcacagggacactgtccaccattgtttctatcgtcaaagac
gaaaatatttctaacccttctatgacaattgttggtgatgttgtttccttacgtaatcaa
atctcttggaaagaacgcaagccattgcacggcaagaaagttttacttgcatctgcaaca
aataaaaaaagcgcaataaagcaaatgttacaagagtccggtgcagaaatatatcaaatt
ccaattttccaaaagaaagaatacacattaacctctgaacaaattaataagatttttaac
gttgatcgtcttgtattttgttccgctgagagtgtagacatcttagtgcaatcatgtagt
aaatatcataaagatattcgctccttacaggcagagcttcagtatatgaacctttctatt
caagaaaagcttatgcaatatggattgttaagtaaacctgcgcaattttcttcgaattca
acgatttatttaggacgaaacattaaccgaattgctgttattcaagaaaaaattggtgct
ggttcctatatgatgactcatgagtacacaattgatcatcgcttcgatgaaattcattcc
cgtatgctttctgaattctcatgggacagcattgtatttgaaggtcgtgcttctattgat
acgtttctagcagaaataaaacgcctaggctttatcaatattcttactctcccattctcg
tataccgacgttccaactttacactatgcgaataaagtcggttttcataatgtagatgag
caattacaagacatgattatgaagaaagatttggtggtacgatga

DBGET integrated database retrieval system