KEGG   Bacillus thuringiensis HD-771: BTG_14480Help
Entry
BTG_14480         CDS       T02293                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTG_14480
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTG_14480
  Amino acid metabolism
   00310 Lysine degradation
    BTG_14480
Enzymes [BR:bti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BTG_14480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2822266..2823525
Genome map
AA seq 419 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPPAEQAKQETAEAPKAAAPNAEQTTSLQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPV
AKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKK
HDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDA
NQLNFAEIESEIRNLGMKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILG
MHKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattaccgaaggaactatttcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggcggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgctaatggagca
ccagttgcagtaagtacacctgcaccacctgctgagcaagcaaaacaagaaacagctgaa
gcaccgaaagctgcggctccaaatgctgaacaaactacgagtctacaaggcttaccaaat
acgaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagtacagatccacttggacgcgtgagaccacatgatgtacaagct
catgctgccgcaccaaaagaagcaccagctgctccaaaaagtccagctcctgctccagtt
gcaaaaacagaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaaca
attgcaaaacgccttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaa
gttgatatgagtgcgatcatggaattacgtaaagagcgtaaagacgctttcgagaaaaaa
catgatgtacgtcttggcttcatgtcattcttcacaaaagcagttgttgcagcattaaaa
caattcccattattaaatgctgaaattcaaggtgacgagcttatcatcaaaaaattctat
gatatcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgct
aaccaattaaacttcgctgaaatcgaaagtgaaattcgtaatttaggtatgaaagcacgc
gataacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggt
gtattcggttctctaatgtcaacaccaatcctaaatagccctcaagttggtattttagga
atgcataaaatccaagtacgcccagttgcaattgataacgagcgtatggaaaaccgccca
atgatgtacattgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagc
ttccttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system