KEGG   Bacillus thuringiensis HD-771: BTG_14480Help
Entry
BTG_14480         CDS       T02293                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00020  Citrate cycle (TCA cycle)
bti00310  Lysine degradation
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
bti01120  Microbial metabolism in diverse environments
bti01130  Biosynthesis of antibiotics
bti01200  Carbon metabolism
Module
bti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTG_14480
  Amino acid metabolism
   00310 Lysine degradation
    BTG_14480
Enzymes [BR:bti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BTG_14480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFQ16348
UniProt: J3U3U4
Position
2822266..2823525
Genome map
AA seq 419 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPPAEQAKQETAEAPKAAAPNAEQTTSLQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPV
AKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKK
HDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDA
NQLNFAEIESEIRNLGMKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILG
MHKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattaccgaaggaactatttcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggcggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgctaatggagca
ccagttgcagtaagtacacctgcaccacctgctgagcaagcaaaacaagaaacagctgaa
gcaccgaaagctgcggctccaaatgctgaacaaactacgagtctacaaggcttaccaaat
acgaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagtacagatccacttggacgcgtgagaccacatgatgtacaagct
catgctgccgcaccaaaagaagcaccagctgctccaaaaagtccagctcctgctccagtt
gcaaaaacagaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaaca
attgcaaaacgccttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaa
gttgatatgagtgcgatcatggaattacgtaaagagcgtaaagacgctttcgagaaaaaa
catgatgtacgtcttggcttcatgtcattcttcacaaaagcagttgttgcagcattaaaa
caattcccattattaaatgctgaaattcaaggtgacgagcttatcatcaaaaaattctat
gatatcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgct
aaccaattaaacttcgctgaaatcgaaagtgaaattcgtaatttaggtatgaaagcacgc
gataacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggt
gtattcggttctctaatgtcaacaccaatcctaaatagccctcaagttggtattttagga
atgcataaaatccaagtacgcccagttgcaattgataacgagcgtatggaaaaccgccca
atgatgtacattgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagc
ttccttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system